Clone FI01004 Report

Search the DGRC for FI01004

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:10
Well:4
Vector:pFlc-1
Associated Gene/TranscriptDif-RA
Protein status:FI01004.pep: gold
Sequenced Size:2493

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Dif 2008-04-29 Release 5.5 accounting
Dif 2008-08-15 Release 5.9 accounting
Dif 2008-12-18 5.12 accounting

Clone Sequence Records

FI01004.complete Sequence

2493 bp (2493 high quality bases) assembled on 2006-09-12

GenBank Submission: BT025231

> FI01004.complete
AGTTTCAATCTGAACTTGGCCGCCGACGGACGTGAAGCGCCGACTTGTTC
ACACATAGATATCCATACATATATATATACATATAGATGTACATATAACG
CATATTGTGCAAGTCGCACGCGACTATATAGCTGCCAGTGTATTGGTTAA
TTATACGAAGCACGACAACTACAACGTAAACTACAGATGCAATCAACTGT
GTAATCCAATGTTTGAGGAGGCTTTCGGCGATATACAGGAAATTATCAAT
GCCAGCATGGAGTTGAATGGTGGCGCCACCGGCGGAGGCAGTGTGGCAGG
AGCTGTTGGCGGAGGCGGTGCTGCACATCACATATTATCGCAGTCGACTT
CCCTGCCGGTAATGCCGTCGCACATTCCGCTCCACCTGCAGAATCAGAAT
ATGAATCAGAATCTGCCCGAGCCAAGTGCAAGAAGTGGTCCCCACCTGCG
TATCGTGGAGGAGCCGACAAGCAATATAATCCGCTTTCGCTACAAATGCG
AGGGTCGCACCGCCGGTTCGATTCCGGGCATGAACTCCAGCTCGGAAACG
GGCAAGACCTTTCCCACCATCGAAGTGTGCAACTACGATGGACCCGTCAT
CATCGTGGTCTCCTGTGTGACGAGCGACGAGCCCTTCCGCCAGCATCCCC
ACTGGCTGGTCAGCAAGGAGGAGGCGGATGCCTGCAAGTCGGGCATCTAC
CAAAAGAAATTGCCGCCAGAGGAGCGGCGGCTGGTGCTCCAAAAAGTGGG
CATACAGTGCGCCAAGAAGCTGGAGATGCGCGACTCGCTGGTGGAGAGGG
AAAGGAGAAACATCGATCCCTTCAATGCCAAATTCGATCACAAGGACCAG
ATCGACAAGATCAATCGGTATGAGTTGCGCCTCTGCTACCAGGCCTTCAT
CACAGTGGGCAACTCAAAAGTGCCCCTGGATCCCATCGTATCCTCACCGA
TTTACGGCAAGAGCAGCGAACTGACCATCACCCGGCTGTGCAGTTGCGCG
GCCACTGCGAACGGCGGCGACGAGATCATCATGCTGTGCGAGAAGATTGC
CAAGGACGACATCGAGGTGCGATTCTATGAGACGGACAAGGATGGACGGG
AGACGTGGTTCGCCAACGCAGAGTTCCAACCCACGGACGTGTTCAAACAG
ATGGCCATAGCTTTTAAGACGCCGCGCTACAGGAACACCGAGATCACACA
AAGTGTTAATGTGGAGCTGAAACTAGTGAGACCCTCGGATGGAGCGACGA
GTGCCCCACTGCCGTTCGAGTACTACCCGAATCCAGAACTCCTAACCAAA
CACAATCGCCGTGTTGCCCAAAAAACAGTTGAAAGCCTAAAGCGCAGTCT
CATGAGCACCAATTTACATCCATCCAAGCAGGTTAAAACCTCCAGCCAGT
ATACGATATTTTCCAAGCCACAAATTGCGACCACAACACCGCAGACACAG
GTGTCGCCTGGTATGCCTTTGATGTTTCCCGGCGGAAGTCCCAATTTTGT
GCAGGATATCAAGATGGAGAATGGATTCATGGATGTGGATAGCCAGAGTA
GCCAGTGTCCATCAGTGGAACGCAATTTCGCTTCGCCTCGATCCAACTGC
AGTACAGTGGATAGTATTCCGCCGATGCAAATGGGGCAAAATCAAACTCA
TCTTTATTTGCCAGATGCCACAAACTTCACATTTAATGGGAATTTCGCAT
CGCCTTCGTCCAATTGCAGTACAGTGGATAGCATTCCGCCGTTTCAAATC
GGACAGAGGAATAACCATATGTATCTGCCGGAGAATTCAAACTTTCCGGT
AAACGGCTGTAGTCCTACCCATTTCAGTGGTGGCTCTATGACACCAATCA
ATAATAACAACAATGTACTAATTAATAACAATAACAATGACTTTTTAAGT
CAGAAAATGAGTGCCATAAGCATACCGCCACAAGGAAATTTTGGCATTAA
ACAGGTATATCAACAGACTCAGCAGTTCCTGCCGCAATTGCAGCCAGAGT
CCATTCCATATCTGGCCCAATCCCATCCAGAACAGTCGCAGTACCAACAG
CAACAGCAGCCACAGGAGCAGCAACCTCCAGCAGATGAACCCACCCAATC
GTTTAGTGATCTAATTTCCAGCAGCATAGGCATGGCGCCCATTGACACCA
GCGAACTTATCCAGGACATTGAGGCAGAACTCAATAGCTTAGGAATTCAG
CCATTCAAATGAACAACAAACTTTGCTAAATACTAGTGTACATATATTTC
ATAAAATATATCGGAAATTAACCAATTAGAGCTACATGTAAAAAGGTCTC
AATCCAAAATGAACTTCAACACAAAACCTGTCTTATATAATTCTATTTTA
CCGCAATGTACATAAATTTAATGAGGGAAATGCGAATCTCATTGCCCGAT
GCCTTGTTACGACTTTTCGTTATTGACAAAAGTGAATTGAAAATGATTAT
TGTTTAAATAAAATATAACTTTAGAATTTAAAAAAAAAAAAAA

FI01004.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dif-RB 2483 Dif-RB 5..2483 1..2479 12380 99.9 Plus
Dif-RA 2836 Dif-RA 546..2836 189..2479 11440 99.9 Plus
Dif-RD 2595 Dif-RD 305..2595 189..2479 11440 99.9 Plus
Dif-RA 2836 Dif-RA 8..194 3..189 935 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17411901..17412985 2479..1395 5410 99.9 Minus
chr2L 23010047 chr2L 17417141..17417731 827..237 2925 99.7 Minus
chr2L 23010047 chr2L 17416642..17417028 1213..827 1935 100 Minus
chr2L 23010047 chr2L 17426646..17426834 189..1 945 100 Minus
chr2L 23010047 chr2L 17413933..17414043 1395..1285 555 100 Minus
chr2L 23010047 chr2L 17416224..17416299 1286..1211 380 100 Minus
chr2L 23010047 chr2L 17418720..17418767 236..189 240 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dif-RD 2004 CG6794-PD 1..2004 209..2212 10005 100 Plus
Dif-RB 2004 CG6794-PB 1..2004 209..2212 10005 100 Plus
Dif-RA 2004 CG6794-PA 1..2004 209..2212 10005 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:04:21 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dif-RB 2483 CG6794-RB 5..2483 1..2479 12380 100 Plus
Dif-RD 2595 CG6794-RD 305..2595 189..2479 11440 100 Plus
Dif-RA 2835 CG6794-RA 545..2835 189..2479 11440 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dif-PD 667 CG6794-PD 1..667 209..2209 3002 100 Plus
Dif-PB 667 CG6794-PB 1..667 209..2209 3002 100 Plus
Dif-PA 667 CG6794-PA 1..667 209..2209 3002 100 Plus
Dif-PC 987 CG6794-PC 1..363 209..1297 1701 99.2 Plus
dl-PB 677 CG6667-PB 42..341 425..1327 723 48.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17413247..17414332 2480..1395 5415 99.9 Minus
2L 23513712 2L 17418488..17419078 827..237 2955 100 Minus
2L 23513712 2L 17417989..17418375 1213..827 1935 100 Minus
2L 23513712 2L 17428007..17428195 189..1 945 100 Minus
2L 23513712 2L 17415280..17415390 1395..1285 555 100 Minus
2L 23513712 2L 17417571..17417646 1286..1211 380 100 Minus
2L 23513712 2L 17420066..17420113 236..189 240 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17413247..17414332 2480..1395 5415 99.9 Minus
2L 23513712 2L 17418488..17419078 827..237 2955 100 Minus
2L 23513712 2L 17417989..17418375 1213..827 1935 100 Minus
2L 23513712 2L 17428007..17428195 189..1 945 100 Minus
2L 23513712 2L 17415280..17415390 1395..1285 555 100 Minus
2L 23513712 2L 17417571..17417646 1286..1211 380 100 Minus
2L 23513712 2L 17420066..17420113 236..189 240 100 Minus
Blast to na_te.dros performed 2014-11-26 19:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2286..2388 1975..2075 159 63.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6774..6920 1950..2094 154 57.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2365..2437 2031..2101 144 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2421 1961..2075 143 58.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6752..6817 2018..2084 143 70.1 Plus
roo 9092 roo DM_ROO 9092bp 1073..1132 2024..2084 140 72.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6731..6809 2018..2094 138 65.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6709..6838 1948..2084 136 59.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6788 2031..2094 127 68.2 Plus
roo 9092 roo DM_ROO 9092bp 1095..1170 2034..2109 127 66.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6771..6815 2031..2075 126 75.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2728..2800 2011..2083 121 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2325..2372 2039..2084 118 75 Plus

FI01004.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:26:31 Download gff for FI01004.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17418720..17418767 189..236 100 <- Minus
chr2L 17417141..17417731 237..827 99 <- Minus
chr2L 17416645..17417027 828..1210 100 <- Minus
chr2L 17416224..17416299 1211..1286 100 <- Minus
chr2L 17413934..17414041 1287..1394 100 <- Minus
chr2L 17411901..17412985 1395..2479 95 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:04:35 Download gff for FI01004.complete
Subject Subject Range Query Range Percent Splice Strand
Dif-RB 1..2004 209..2212 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:20:42 Download gff for FI01004.complete
Subject Subject Range Query Range Percent Splice Strand
Dif-RD 1..2004 209..2212 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:52:26 Download gff for FI01004.complete
Subject Subject Range Query Range Percent Splice Strand
Dif-RA 1..2004 209..2212 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:51:19 Download gff for FI01004.complete
Subject Subject Range Query Range Percent Splice Strand
Dif-RB 1..2004 209..2212 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:26:31 Download gff for FI01004.complete
Subject Subject Range Query Range Percent Splice Strand
Dif-RA 1..2004 209..2212 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:04:35 Download gff for FI01004.complete
Subject Subject Range Query Range Percent Splice Strand
Dif-RB 1..2479 1..2479 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:20:42 Download gff for FI01004.complete
Subject Subject Range Query Range Percent Splice Strand
Dif-RB 1..2479 1..2479 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:52:26 Download gff for FI01004.complete
Subject Subject Range Query Range Percent Splice Strand
Dif-RB 5..2483 1..2479 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:51:19 Download gff for FI01004.complete
Subject Subject Range Query Range Percent Splice Strand
Dif-RB 1..2479 1..2479 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:26:31 Download gff for FI01004.complete
Subject Subject Range Query Range Percent Splice Strand
Dif-RB 5..2483 1..2479 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:26:31 Download gff for FI01004.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17428008..17428195 1..188 100   Minus
2L 17420066..17420113 189..236 100 <- Minus
2L 17418488..17419078 237..827 100 <- Minus
2L 17417992..17418374 828..1210 100 <- Minus
2L 17417571..17417646 1211..1286 100 <- Minus
2L 17415281..17415388 1287..1394 100 <- Minus
2L 17413248..17414332 1395..2479 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:52:26 Download gff for FI01004.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17428008..17428195 1..188 100   Minus
arm_2L 17420066..17420113 189..236 100 <- Minus
arm_2L 17418488..17419078 237..827 100 <- Minus
arm_2L 17417992..17418374 828..1210 100 <- Minus
arm_2L 17417571..17417646 1211..1286 100 <- Minus
arm_2L 17415281..17415388 1287..1394 100 <- Minus
arm_2L 17413248..17414332 1395..2479 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:09:03 Download gff for FI01004.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17428008..17428195 1..188 100   Minus
2L 17420066..17420113 189..236 100 <- Minus
2L 17418488..17419078 237..827 100 <- Minus
2L 17417992..17418374 828..1210 100 <- Minus
2L 17417571..17417646 1211..1286 100 <- Minus
2L 17415281..17415388 1287..1394 100 <- Minus
2L 17413248..17414332 1395..2479 99 <- Minus

FI01004.pep Sequence

Translation from 208 to 2211

> FI01004.pep
MFEEAFGDIQEIINASMELNGGATGGGSVAGAVGGGGAAHHILSQSTSLP
VMPSHIPLHLQNQNMNQNLPEPSARSGPHLRIVEEPTSNIIRFRYKCEGR
TAGSIPGMNSSSETGKTFPTIEVCNYDGPVIIVVSCVTSDEPFRQHPHWL
VSKEEADACKSGIYQKKLPPEERRLVLQKVGIQCAKKLEMRDSLVERERR
NIDPFNAKFDHKDQIDKINRYELRLCYQAFITVGNSKVPLDPIVSSPIYG
KSSELTITRLCSCAATANGGDEIIMLCEKIAKDDIEVRFYETDKDGRETW
FANAEFQPTDVFKQMAIAFKTPRYRNTEITQSVNVELKLVRPSDGATSAP
LPFEYYPNPELLTKHNRRVAQKTVESLKRSLMSTNLHPSKQVKTSSQYTI
FSKPQIATTTPQTQVSPGMPLMFPGGSPNFVQDIKMENGFMDVDSQSSQC
PSVERNFASPRSNCSTVDSIPPMQMGQNQTHLYLPDATNFTFNGNFASPS
SNCSTVDSIPPFQIGQRNNHMYLPENSNFPVNGCSPTHFSGGSMTPINNN
NNVLINNNNNDFLSQKMSAISIPPQGNFGIKQVYQQTQQFLPQLQPESIP
YLAQSHPEQSQYQQQQQPQEQQPPADEPTQSFSDLISSSIGMAPIDTSEL
IQDIEAELNSLGIQPFK*

FI01004.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 22:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15105-PA 622 GF15105-PA 19..482 42..546 1711 65.2 Plus
Dana\GF15103-PA 680 GF15103-PA 51..350 73..373 726 48 Plus
Dana\GF18430-PA 977 GF18430-PA 133..449 69..368 426 36.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 22:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21748-PA 666 GG21748-PA 1..666 1..667 2976 90.3 Plus
Dere\GG21746-PA 683 GG21746-PA 42..341 73..373 743 48.7 Plus
Dere\GG17396-PA 961 GG17396-PA 148..455 78..368 422 36.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 22:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10078-PA 967 GH10078-PA 16..364 3..372 1262 64.2 Plus
Dgri\GH10077-PA 708 GH10077-PA 42..341 73..373 739 48.2 Plus
Dgri\GH18237-PA 974 GH18237-PA 152..457 80..368 400 36.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dif-PD 667 CG6794-PD 1..667 1..667 3510 100 Plus
Dif-PB 667 CG6794-PB 1..667 1..667 3510 100 Plus
Dif-PA 667 CG6794-PA 1..667 1..667 3510 100 Plus
Dif-PC 987 CG6794-PC 1..363 1..363 1893 99.2 Plus
dl-PB 677 CG6667-PB 7..341 20..373 725 45.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 22:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16552-PA 962 GI16552-PA 4..350 3..372 1260 64.2 Plus
Dmoj\GI16541-PA 705 GI16541-PA 53..352 73..373 739 48.5 Plus
Dmoj\GI10193-PA 956 GI10193-PA 144..450 80..369 396 35.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 22:42:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18755-PA 659 GL18755-PA 4..627 3..655 1841 61.6 Plus
Dper\GL18753-PA 707 GL18753-PA 54..353 73..373 741 48.5 Plus
Dper\GL12490-PA 878 GL12490-PA 44..351 80..368 424 36.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 22:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19867-PA 659 GA19867-PA 4..627 3..655 1839 61.6 Plus
Dpse\GA19765-PA 700 GA19765-PA 55..354 73..373 742 48.5 Plus
Dpse\GA11317-PA 968 GA11317-PA 136..441 80..368 434 37.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 22:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17131-PA 664 GM17131-PA 1..664 1..667 3120 94 Plus
Dsec\GM17128-PA 677 GM17128-PA 42..341 73..373 744 48.7 Plus
Dsec\Rel-PA 970 GM26286-PA 150..459 78..370 437 37.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 22:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Dif-PA 662 GD21872-PA 1..662 1..667 3144 94.8 Plus
Dsim\dl-PA 679 GD21870-PA 42..341 73..373 747 49 Plus
Dsim\Rel-PA 972 GD20822-PA 150..457 78..368 431 37.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 22:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16233-PA 603 GJ16233-PA 7..439 45..481 1303 58 Plus
Dvir\GJ16232-PA 697 GJ16232-PA 54..353 73..373 740 48.5 Plus
Dvir\GJ23481-PA 960 GJ23481-PA 145..451 80..369 408 36.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 22:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24830-PA 908 GK24830-PA 3..315 41..359 1294 75.5 Plus
Dwil\GK10525-PA 701 GK10525-PA 48..347 73..373 743 48.7 Plus
Dwil\GK14061-PA 929 GK14061-PA 132..437 80..368 399 35.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 22:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Dif-PA 622 GE13138-PA 1..620 1..664 2006 64.7 Plus
Dyak\dl-PA 672 GE13136-PA 43..342 73..373 746 49 Plus
Dyak\Rel-PA 973 GE24800-PA 148..455 78..368 424 37.2 Plus

FI01004.hyp Sequence

Translation from 208 to 2211

> FI01004.hyp
MFEEAFGDIQEIINASMELNGGATGGGSVAGAVGGGGAAHHILSQSTSLP
VMPSHIPLHLQNQNMNQNLPEPSARSGPHLRIVEEPTSNIIRFRYKCEGR
TAGSIPGMNSSSETGKTFPTIEVCNYDGPVIIVVSCVTSDEPFRQHPHWL
VSKEEADACKSGIYQKKLPPEERRLVLQKVGIQCAKKLEMRDSLVERERR
NIDPFNAKFDHKDQIDKINRYELRLCYQAFITVGNSKVPLDPIVSSPIYG
KSSELTITRLCSCAATANGGDEIIMLCEKIAKDDIEVRFYETDKDGRETW
FANAEFQPTDVFKQMAIAFKTPRYRNTEITQSVNVELKLVRPSDGATSAP
LPFEYYPNPELLTKHNRRVAQKTVESLKRSLMSTNLHPSKQVKTSSQYTI
FSKPQIATTTPQTQVSPGMPLMFPGGSPNFVQDIKMENGFMDVDSQSSQC
PSVERNFASPRSNCSTVDSIPPMQMGQNQTHLYLPDATNFTFNGNFASPS
SNCSTVDSIPPFQIGQRNNHMYLPENSNFPVNGCSPTHFSGGSMTPINNN
NNVLINNNNNDFLSQKMSAISIPPQGNFGIKQVYQQTQQFLPQLQPESIP
YLAQSHPEQSQYQQQQQPQEQQPPADEPTQSFSDLISSSIGMAPIDTSEL
IQDIEAELNSLGIQPFK*

FI01004.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dif-PD 667 CG6794-PD 1..667 1..667 3510 100 Plus
Dif-PB 667 CG6794-PB 1..667 1..667 3510 100 Plus
Dif-PA 667 CG6794-PA 1..667 1..667 3510 100 Plus
Dif-PC 987 CG6794-PC 1..363 1..363 1893 99.2 Plus
dl-PB 677 CG6667-PB 7..341 20..373 725 45.4 Plus