Clone FI01024 Report

Search the DGRC for FI01024

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:10
Well:24
Vector:pFlc-1
Associated Gene/Transcriptfu2-RA
Protein status:FI01024.pep: gold
Sequenced Size:1997

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
fu2 2008-04-29 Release 5.5 accounting
fu2 2008-08-15 Release 5.9 accounting
fu2 2008-12-18 5.12 accounting

Clone Sequence Records

FI01024.complete Sequence

1997 bp assembled on 2006-11-21

GenBank Submission: BT025217

> FI01024.complete
GACTATCGTGGTAGATTGGCCATTGACCAACGCGTTTTATTTGCTACCGG
TGTGGCTTTTGTTTGCTTAAACAATTGGATAATTTATTGCAATCCCGGCT
TAAATGCATATGATTGAAGAATGCATACATCGGATATCAGCATGACCCAG
GATCAGGATGTGAGCACTTGTCGCCTGTGCCACCATAATACGGATCCCAA
CTCGCTAAACATTTTCGATGACACCGTGCAGTTTTGCAAGGATGTGTCCA
TTGCAGAGGTTTCCAAGAGTCTCTGGAGCGTTCAGTACGATCGCAACGAA
TGTTTGTCGGAGCTCATTTGCTCAAGGTGTCTGGAGATCCTCGAAGAGGC
ATTCGAGCTGCGAAAAGGAATGCAGGAGCGGGAACAGTCCCTGCAGGAGC
AGCTGAAGGAGATGATTAAAGATCATCCGAAGCACCGTCCAGGCCTGAAT
GGCAACCCCGGAGTATTCGTACCCGAGGAGGGCTGCATTATTGTGGAAGT
TGATCCAGAGAATCTGGCAGAGAGCAGTGAAGAGGAATTCGCACTCGGCT
CCGATGGGGAGTACGAAAACTATGACGACGATGATGAGGAGGAGGAGGAA
GACTACGATGAGGAGGACGAGGAAGATGGCCAGAACGGCGAAGACGTCGA
CATGCCACTGGGCATGGATGCGGCCCAGATGGCGGCTCAACAGTCCGTTG
CCAACAACGCCAACACCACGGAGGCACGGCCAAAGCGAGCGTTCCTCTGT
CAATACTGTGATCTTGGGTTCACTCTGCCCGCCGAGTGTCAAGAGCACGA
GCTGGCTGCACACGATCCCAACGCACCGTACTGCTGCAACTTTTGCAACA
TCAAGCTGGTTACCCGGCCTGCTTTGATTTCGCACATAAAGACACTGCAT
GATCCGGACCGTCCGTATGTGTGTGCTCACTGTCGGAAGGGTTTTGTGCG
CCGCTCCGATCTTAAAAAGCACACAATCGTGCACACTGGCGTGAGGCCCT
TCACATGCAACGTTTGCTCCAAGAGTTTCTCGCGGAATACAAATCTGACC
AAGCACATGCGCATTCATAGCGGTGTCAAGCCCTTTGTTTGCCAGCAGTG
TCCGCGATCCTTCCAGACGGCTGTGGAAATGATGCGCCACACACGTTCGC
ACGGAGAGGTAAAGGCTTTCCAATGTGGACGCTGTCCCTACTCGTTTTCG
CGCAGGGATAAGCTAATAGCCCACCAGCAAGTCCATACCAGGCGGGACAT
GGAGCAGCAGCAGCAAATGGGTCTAATTCCCCCGATGGAGGGTGATCTGC
AGCAGCAGGCGTTGCAGGCTAAACAAAAGGCTGCCGCACAAACCAAAAAC
TCACGCTATTACCACTGTGATGTCTGCGATCGAACTTTCCAACGGGAGAG
GGACCTGCAACGCCATCAAGCTCTTCACATGGACTCGCTGTTCGCCTGCA
AGACATGTAATCAAGGTTTCAACCGACGCGAGCAACTGCAGCGCCATGAG
CTAGAGGCTCATGGTCCCAGCTTTACGTGCGGAATCTGTTGCATTAGCTT
CCTGCATCAAATTGAGCTGGAGAATCACCTCAAAGTCCATCAGTTGCAGC
ACAAGATGGCCCAGCGGGCTCAAGAGGCTGCTATTTTACCCCTAAAAATG
GCCGAAAAGGCTCCAGTGGCTATGACGGCTCCGCTAGTTCAGGATCCCCA
GCTAGTGCGTCCCTCGGCAGCGGAACTGTCGTTCTACAGCAACATGATTC
CCACAATGAATCTGGGCTTCTACAGCGAGACTCGTCCCGAGGAATAGAAC
AACATATTTACATGTTTAATAAGCTTAGTTGATAGGTCGGAAAAGTTTTG
TAGGTCAAGGCTGTTTTAGTCGTTCAGGTCAACATAGAATCCATTGGTGT
TAATGAATCTGTATAGTTTAAGTCATCTGACTATTGTCTGCCAAAATGTA
GCTTAGTGGTTTTTAATAAAAGGCCAAATCTGAAAAAAAAAAAAAAA

FI01024.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
fu2-RA 2246 fu2-RA 63..2046 2..1985 9905 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8463738..8465437 283..1982 8470 99.9 Plus
chr2L 23010047 chr2L 8463399..8463682 2..285 1420 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
fu2-RB 1677 CG9233-PB 1..1677 121..1797 8370 99.9 Plus
fu2-RA 1677 CG9233-PA 1..1677 121..1797 8370 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:04:44 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
fu2-RB 2149 CG9233-RB 4..1984 2..1982 9890 99.9 Plus
fu2-RA 1984 CG9233-RA 4..1984 2..1982 9890 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
fu2-PB 558 CG9233-PB 1..558 121..1794 2721 100 Plus
fu2-PA 558 CG9233-PA 1..558 121..1794 2721 100 Plus
Meics-PB 571 CG8474-PB 285..570 733..1599 376 28.9 Plus
Meics-PA 583 CG8474-PA 297..582 733..1599 376 28.9 Plus
crol-PG 878 CG14938-PG 333..587 742..1623 371 28.6 Plus
Meics-PB 571 CG8474-PB 225..450 820..1590 308 26 Plus
Meics-PA 583 CG8474-PA 237..462 820..1590 308 26 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8464830..8466532 283..1985 8500 99.9 Plus
2L 23513712 2L 8464491..8464774 2..285 1420 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8464830..8466532 283..1985 8500 99.9 Plus
2L 23513712 2L 8464491..8464774 2..285 1420 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:15:37 has no hits.

FI01024.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:39:13 Download gff for FI01024.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8464107..8465437 652..1982 99   Plus
chr2L 8463741..8464017 286..562 100 == Plus
chr2L 8463398..8463682 1..285 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:34:44 Download gff for FI01024.complete
Subject Subject Range Query Range Percent Splice Strand
fu2-RA 1..1677 121..1797 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:19:57 Download gff for FI01024.complete
Subject Subject Range Query Range Percent Splice Strand
fu2-RA 1..1677 121..1797 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:47 Download gff for FI01024.complete
Subject Subject Range Query Range Percent Splice Strand
fu2-RA 1..1677 121..1797 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:32:54 Download gff for FI01024.complete
Subject Subject Range Query Range Percent Splice Strand
fu2-RA 1..1677 121..1797 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:39:13 Download gff for FI01024.complete
Subject Subject Range Query Range Percent Splice Strand
fu2-RA 1..1677 121..1797 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:47:02 Download gff for FI01024.complete
Subject Subject Range Query Range Percent Splice Strand
fu2-RA 2..1982 2..1982 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:19:57 Download gff for FI01024.complete
Subject Subject Range Query Range Percent Splice Strand
fu2-RA 1..1981 2..1982 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:47 Download gff for FI01024.complete
Subject Subject Range Query Range Percent Splice Strand
fu2-RA 3..1984 1..1982 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:32:55 Download gff for FI01024.complete
Subject Subject Range Query Range Percent Splice Strand
fu2-RA 2..1982 2..1982 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:39:13 Download gff for FI01024.complete
Subject Subject Range Query Range Percent Splice Strand
fu2-RA 3..1984 1..1982 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:39:13 Download gff for FI01024.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8464833..8466529 286..1982 99   Plus
2L 8464490..8464774 1..285 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:47 Download gff for FI01024.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8464833..8466529 286..1982 99   Plus
arm_2L 8464490..8464774 1..285 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:08:31 Download gff for FI01024.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8464833..8466529 286..1982 99   Plus
2L 8464490..8464774 1..285 99 -> Plus

FI01024.pep Sequence

Translation from 120 to 1796

> FI01024.pep
MHTSDISMTQDQDVSTCRLCHHNTDPNSLNIFDDTVQFCKDVSIAEVSKS
LWSVQYDRNECLSELICSRCLEILEEAFELRKGMQEREQSLQEQLKEMIK
DHPKHRPGLNGNPGVFVPEEGCIIVEVDPENLAESSEEEFALGSDGEYEN
YDDDDEEEEEDYDEEDEEDGQNGEDVDMPLGMDAAQMAAQQSVANNANTT
EARPKRAFLCQYCDLGFTLPAECQEHELAAHDPNAPYCCNFCNIKLVTRP
ALISHIKTLHDPDRPYVCAHCRKGFVRRSDLKKHTIVHTGVRPFTCNVCS
KSFSRNTNLTKHMRIHSGVKPFVCQQCPRSFQTAVEMMRHTRSHGEVKAF
QCGRCPYSFSRRDKLIAHQQVHTRRDMEQQQQMGLIPPMEGDLQQQALQA
KQKAAAQTKNSRYYHCDVCDRTFQRERDLQRHQALHMDSLFACKTCNQGF
NRREQLQRHELEAHGPSFTCGICCISFLHQIELENHLKVHQLQHKMAQRA
QEAAILPLKMAEKAPVAMTAPLVQDPQLVRPSAAELSFYSNMIPTMNLGF
YSETRPEE*

FI01024.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 19:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15528-PA 571 GF15528-PA 14..571 14..558 2074 72.1 Plus
Dana\GF17156-PA 633 GF17156-PA 348..595 206..460 321 32.7 Plus
Dana\GF11351-PA 278 GF11351-PA 16..233 208..434 315 31.6 Plus
Dana\GF15824-PA 738 GF15824-PA 294..542 266..491 312 29.1 Plus
Dana\GF10403-PA 578 GF10403-PA 291..574 206..493 309 28.1 Plus
Dana\GF17156-PA 633 GF17156-PA 321..595 237..491 265 26.6 Plus
Dana\GF15824-PA 738 GF15824-PA 375..541 205..372 257 33.3 Plus
Dana\GF17156-PA 633 GF17156-PA 429..598 205..376 242 30.8 Plus
Dana\GF15824-PA 738 GF15824-PA 347..513 205..372 242 30.4 Plus
Dana\GF11351-PA 278 GF11351-PA 72..222 206..359 197 32.1 Plus
Dana\GF11351-PA 278 GF11351-PA 11..236 289..464 162 22.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 19:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25285-PA 558 GG25285-PA 1..558 1..558 2574 88.9 Plus
Dere\GG18916-PA 506 GG18916-PA 11..387 127..490 347 29 Plus
Dere\GG13746-PA 574 GG13746-PA 289..573 206..493 336 29.4 Plus
Dere\GG18735-PA 522 GG18735-PA 137..414 239..520 331 29.8 Plus
Dere\GG16687-PA 410 GG16687-PA 16..404 62..490 328 26.7 Plus
Dere\GG18916-PA 506 GG18916-PA 168..443 206..490 298 30.6 Plus
Dere\GG18916-PA 506 GG18916-PA 281..496 208..460 282 29.1 Plus
Dere\GG13746-PA 574 GG13746-PA 228..453 234..490 251 25.2 Plus
Dere\GG18916-PA 506 GG18916-PA 335..497 206..370 233 33.3 Plus
Dere\GG16687-PA 410 GG16687-PA 239..407 177..347 216 29.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 19:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10955-PA 626 GH10955-PA 29..622 17..558 1632 57.1 Plus
Dgri\GH24873-PA 528 GH24873-PA 161..438 239..520 324 29 Plus
Dgri\GH20674-PA 732 GH20674-PA 324..570 206..487 317 29.9 Plus
Dgri\GH22118-PA 278 GH22118-PA 16..233 208..434 314 31.1 Plus
Dgri\GH18613-PA 627 GH18613-PA 344..586 206..459 306 31 Plus
Dgri\GH20674-PA 732 GH20674-PA 317..518 252..490 296 29.2 Plus
Dgri\GH22118-PA 278 GH22118-PA 16..181 237..437 236 27.7 Plus
Dgri\GH24873-PA 528 GH24873-PA 160..352 295..490 201 29.5 Plus
Dgri\GH22118-PA 278 GH22118-PA 72..201 206..339 198 32.1 Plus
Dgri\GH20674-PA 732 GH20674-PA 407..569 205..368 184 27.7 Plus
Dgri\GH22118-PA 278 GH22118-PA 11..180 289..490 157 22.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
fu2-PB 558 CG9233-PB 1..558 1..558 3011 100 Plus
fu2-PA 558 CG9233-PA 1..558 1..558 3011 100 Plus
Meics-PB 571 CG8474-PB 171..570 135..493 392 26 Plus
Meics-PA 583 CG8474-PA 183..582 135..493 392 26 Plus
CG5245-PA 501 CG5245-PA 18..354 152..490 373 29.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 19:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10399-PA 602 GI10399-PA 29..598 17..558 1499 54.5 Plus
Dmoj\GI14705-PA 529 GI14705-PA 147..424 239..520 324 29 Plus
Dmoj\GI19253-PA 278 GI19253-PA 16..238 208..438 312 30.9 Plus
Dmoj\GI23506-PA 777 GI23506-PA 301..550 266..492 305 29.6 Plus
Dmoj\GI10361-PA 595 GI10361-PA 311..553 206..459 301 31 Plus
Dmoj\GI23506-PA 777 GI23506-PA 387..565 210..389 257 32.2 Plus
Dmoj\GI23506-PA 777 GI23506-PA 297..492 290..490 227 30 Plus
Dmoj\GI14705-PA 529 GI14705-PA 146..338 295..490 200 29.5 Plus
Dmoj\GI19253-PA 278 GI19253-PA 72..201 206..339 190 31.3 Plus
Dmoj\GI19253-PA 278 GI19253-PA 11..181 289..437 163 24.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 19:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26127-PA 570 GL26127-PA 13..570 14..558 1714 63.3 Plus
Dper\GL26275-PA 880 GL26275-PA 418..718 185..490 398 32 Plus
Dper\GL16107-PA 352 GL16107-PA 13..347 142..490 337 28.3 Plus
Dper\GL20492-PA 419 GL20492-PA 5..386 17..472 335 26.2 Plus
Dper\GL20556-PA 429 GL20556-PA 5..380 17..472 327 26.1 Plus
Dper\GL26275-PA 880 GL26275-PA 24..434 129..490 298 24.1 Plus
Dper\GL26275-PA 880 GL26275-PA 550..847 206..486 271 28 Plus
Dper\GL20492-PA 419 GL20492-PA 128..349 264..490 271 28.4 Plus
Dper\GL16107-PA 352 GL16107-PA 183..348 206..373 267 33.9 Plus
Dper\GL26275-PA 880 GL26275-PA 381..602 263..490 257 28.3 Plus
Dper\GL26275-PA 880 GL26275-PA 638..849 206..370 241 29 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 19:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21630-PA 570 GA21630-PA 13..570 14..558 1714 63.3 Plus
Dpse\GA26117-PA 423 GA26117-PA 2..418 23..490 371 26.5 Plus
Dpse\GA19755-PA 607 GA19755-PA 323..565 206..459 329 31.8 Plus
Dpse\GA25545-PB 362 GA25545-PB 5..353 17..459 328 25.2 Plus
Dpse\GA23061-PA 507 GA23061-PA 134..411 239..520 323 28.8 Plus
Dpse\GA26117-PA 423 GA26117-PA 254..420 206..374 269 33.7 Plus
Dpse\GA19755-PA 607 GA19755-PA 405..573 206..376 234 31 Plus
Dpse\GA19755-PA 607 GA19755-PA 293..574 263..495 200 23.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 19:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16958-PA 246 GM16958-PA 1..246 313..558 1219 98 Plus
Dsec\GM16954-PA 253 GM16954-PA 1..209 8..216 885 90.9 Plus
Dsec\GM24571-PA 575 GM24571-PA 290..574 206..493 348 30 Plus
Dsec\GM18162-PA 418 GM18162-PA 13..416 42..466 342 26.4 Plus
Dsec\GM18478-PA 345 GM18478-PA 93..344 167..464 325 27.4 Plus
Dsec\GM24571-PA 575 GM24571-PA 229..454 234..490 268 26 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 19:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23545-PA 558 GD23545-PA 1..558 1..558 2676 95 Plus
Dsim\GD12643-PA 575 GD12643-PA 290..574 206..493 346 30 Plus
Dsim\GD22772-PA 392 GD22772-PA 13..387 42..461 336 23.9 Plus
Dsim\GD16713-PA 523 GD16713-PA 135..412 239..520 333 29.8 Plus
Dsim\GD20376-PA 639 GD20376-PA 356..598 206..459 325 32.2 Plus
Dsim\GD12643-PA 575 GD12643-PA 229..454 234..490 268 26 Plus
Dsim\GD16713-PA 523 GD16713-PA 134..326 295..490 201 29.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 19:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18025-PA 516 GJ18025-PA 1..512 73..558 1536 62.5 Plus
Dvir\GJ11385-PA 430 GJ11385-PA 27..412 88..492 339 26.6 Plus
Dvir\GJ16768-PA 522 GJ16768-PA 145..422 239..520 323 29 Plus
Dvir\GJ20331-PA 278 GJ20331-PA 16..233 208..434 317 31.1 Plus
Dvir\GJ20712-PA 735 GJ20712-PA 281..545 266..507 309 29.1 Plus
Dvir\GJ20331-PA 278 GJ20331-PA 16..181 237..437 238 27.7 Plus
Dvir\GJ16768-PA 522 GJ16768-PA 144..336 295..490 200 29.5 Plus
Dvir\GJ20331-PA 278 GJ20331-PA 72..201 206..339 198 32.1 Plus
Dvir\GJ20331-PA 278 GJ20331-PA 13..180 291..490 150 22.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 19:29:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24172-PA 590 GK24172-PA 32..590 17..558 1733 61.4 Plus
Dwil\GK14669-PA 673 GK14669-PA 274..533 266..498 321 28.7 Plus
Dwil\GK25316-PA 531 GK25316-PA 152..428 239..520 319 29.1 Plus
Dwil\GK21835-PA 277 GK21835-PA 14..232 207..434 310 32.3 Plus
Dwil\GK10434-PA 367 GK10434-PA 129..361 206..465 308 29.8 Plus
Dwil\GK14669-PA 673 GK14669-PA 360..521 210..372 251 34.4 Plus
Dwil\GK21835-PA 277 GK21835-PA 7..180 230..437 248 29.5 Plus
Dwil\GK25316-PA 531 GK25316-PA 151..343 295..490 201 29.5 Plus
Dwil\GK21835-PA 277 GK21835-PA 71..179 206..344 188 30.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 19:29:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18775-PA 558 GE18775-PA 1..558 1..558 2547 88.9 Plus
Dyak\GE26193-PA 537 GE26193-PA 11..387 127..490 365 28.5 Plus
Dyak\GE18295-PA 346 GE18295-PA 5..345 17..464 356 25.6 Plus
Dyak\GE18294-PA 346 GE18294-PA 5..344 17..402 347 27.9 Plus
Dyak\GE17974-PA 438 GE17974-PA 14..427 42..490 340 25.2 Plus
Dyak\GE18294-PA 346 GE18294-PA 107..341 221..462 292 30.6 Plus
Dyak\GE26193-PA 537 GE26193-PA 309..525 208..460 277 27.2 Plus
Dyak\GE26193-PA 537 GE26193-PA 224..471 206..490 270 27.9 Plus
Dyak\GE18294-PA 346 GE18294-PA 125..314 268..490 197 26.5 Plus
Dyak\GE18295-PA 346 GE18295-PA 126..288 294..490 193 26.6 Plus

FI01024.hyp Sequence

Translation from 120 to 1796

> FI01024.hyp
MHTSDISMTQDQDVSTCRLCHHNTDPNSLNIFDDTVQFCKDVSIAEVSKS
LWSVQYDRNECLSELICSRCLEILEEAFELRKGMQEREQSLQEQLKEMIK
DHPKHRPGLNGNPGVFVPEEGCIIVEVDPENLAESSEEEFALGSDGEYEN
YDDDDEEEEEDYDEEDEEDGQNGEDVDMPLGMDAAQMAAQQSVANNANTT
EARPKRAFLCQYCDLGFTLPAECQEHELAAHDPNAPYCCNFCNIKLVTRP
ALISHIKTLHDPDRPYVCAHCRKGFVRRSDLKKHTIVHTGVRPFTCNVCS
KSFSRNTNLTKHMRIHSGVKPFVCQQCPRSFQTAVEMMRHTRSHGEVKAF
QCGRCPYSFSRRDKLIAHQQVHTRRDMEQQQQMGLIPPMEGDLQQQALQA
KQKAAAQTKNSRYYHCDVCDRTFQRERDLQRHQALHMDSLFACKTCNQGF
NRREQLQRHELEAHGPSFTCGICCISFLHQIELENHLKVHQLQHKMAQRA
QEAAILPLKMAEKAPVAMTAPLVQDPQLVRPSAAELSFYSNMIPTMNLGF
YSETRPEE*

FI01024.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
fu2-PB 558 CG9233-PB 1..558 1..558 3011 100 Plus
fu2-PA 558 CG9233-PA 1..558 1..558 3011 100 Plus
Meics-PB 571 CG8474-PB 171..570 135..493 392 26 Plus
Meics-PA 583 CG8474-PA 183..582 135..493 392 26 Plus
CG5245-PA 501 CG5245-PA 18..354 152..490 373 29.9 Plus