Clone FI01027 Report

Search the DGRC for FI01027

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:10
Well:27
Vector:pFlc-1
Associated Gene/Transcriptesn-RA
Protein status:FI01027.pep: gold
Sequenced Size:3998

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
esn 2008-04-29 Release 5.5 accounting
esn 2008-08-15 Release 5.9 accounting
esn 2008-12-18 5.12 accounting

Clone Sequence Records

FI01027.complete Sequence

3998 bp assembled on 2007-05-24

GenBank Submission: BT030763

> FI01027.complete
AGTTGCGGTTTGCTATCGCGGCACTACACAACGTGCGGCGGAGTATCCTC
GACAGCCAATCCTTCCCGAACCTTCCTTTCGCGACTCACGACTCTCAACT
CTTCGCGTGCCGCCTCGACTTGCACTTTCTGGTGATTGAGGAGGGTTCCG
AGAACAACAAGAGTGTGTTTAATGAATTCCAATCCACAAACGCGTGTGCA
TAATTGAATAACGAAGGTGAAAATTGAAAATTGAAATGCCAGCAAATTGA
ATTGCCCGGCCGACTCTTTGTCCTCCAGTTTGTCGCCCGTGACATCTCGA
ATTGAATTTCGGTCCGCTCCGGCGCGCAAATTGCTTAACGAGCCAGTGAA
AGTCTAACAAGAAGTCCCGCAAAAAGTACGTGCAGCGGCGGAATTTCTAA
TTGGATTAGAAGTGAACCACCCCAACCCGGGTCCGAGAAAAGTCGACGAT
TCCCGTTGGTGAAACAATTTGTTAAAACGCAAACTTCGCAATGGCAATTC
GTTTGGGAGAGTTTTGAAGCACCCAGCCCAGCCAAGTAATCGAAAAATTC
AAGCCCACGCCCGCACCCCGCTCTTCCGGCAACATGCAGCAGGCCCCGCA
GCAGCAGCAGCATCCCCATCCGCCCAGCAGCAGCTACTACACGCAAACCG
AAAGCGAGCTGCTGCAGATTGAGGCGGGCGGCACGGGCCTGACCTTCGCC
TCCCACTCGCAACGTCCCGAATCGGCGATCAGTCAGGTGGCATCCACCGC
CCACCTGGACGTGCCCTCGGCCGCCTCCAGCGGCAGCGGGGGCAGTGCAG
TCAGTGGGGGAAGCGGCGGAGCTCCGGAATCCGCGGGTCGATTTGTGTCC
CCGCTGCAGCGCCGCCACTGCCAGCCGCCCAGCCACCTGCCGCTGAACTC
GGTGGCCTCCCCGCTCCGCACCGCCAGCTACAAGTCGGCGGCGGCGGTCG
CTGGTCATGGCTTCCACCACAGCCATCACCAGCAGCTGGACTTCCAGCGG
AACTCGCAGTCGGACGACGACAGCGGCTGTGCCCTCGAGGAGTACACTTG
GGTGCCGCCGGGTCTGCGGCCCGATCAGGTCCGTTTGTACTTCAGTCAAC
TGCCAGACGACAAAGTGCCCTACGTCAACAGTCCCGGCGAAAAGTATCGT
GTCAAGCAGTTGCTGCACCAGCTGCCGCCGCAAGATAACGAAGTGCGCTA
CTGCCACTCGCTGAGCGACGAGGAGCGCAAGGAGCTGCGCATCTTCTCGG
CCCAAAGGAAGCGGGAGGCCCTCGGACGAGGGGCGGTCCGTCTGCTGTCC
GACGAGCGGCCCTGCAAGGGGTGCGAGGAGCCTTTGTCCGGCGGTGACAT
CGTGGTTTTCGCCCAGCGCCTGGGCGCCCAGTTGTGTTGGCATCCGGGCT
GCTTTGTGTGCAGCGTCTGCAAGGAGCTCCTGGTGGACCTCATCTACTTC
CAGCGGGACGGGAACCTCTACTGCGGTCGGCACCATGCCGAAACCCAGAA
GCCACGCTGCTCCGCCTGCGATGAGATCATCTTCTCGGACGAGTGCACGG
AGGCGGAGGGCAGAACGTGGCACATGAAGCACTTCGCCTGCCAGGAGTGC
GAGCACCAGCTGGGCGGGCAGCGGTACATCATGCGGGAGGGCAAACCGTA
CTGTCTGGCCTGCTTCGACACAATGTTCGCCGAGTACTGCGACTACTGCG
GGGAGGTAATCGGCGTGGACCAGGGCCAGATGAGCCACGACGGGCAGCAC
TGGCATGCGACGGACCAGTGCTTCAGCTGCTGCACCTGCCGCTGTTCGCT
GCTGGGAAGGCCCTTCCTGCCCAGAAGGGGCACCATCTACTGCTCGATCG
CCTGTAGCAAAGGTGAGCCGCCCACGCCGTCAGACACGAGTTCGGGTCCC
CAGCTAAGGCCGACTCACCGAGCTTCCACCTCCAGCCAAATAGCTAAATC
GCCGCGTAGAGGTGGAGAGCGGGAGCGGGATCCGGGACGGAAGGCCCACC
ACGGTCACCCGAAGGCTACGGGCAGTGCAGGCGATCTGCTTGAGCGGCAG
GAAAGGCAGCGCATGGAGGCCGCGGGAGTGGCGGACCTACTGCTCGGAGG
AGGAGTACCGGGCATGCCTCGCCCAGCCCATCCACCGCCCATCGACCTAA
CCGAGTTGGGGATCAGCCTGGACAACATTTGTGCCGGCGACAAGTCCATC
TTCGGGGACACCCAGACCCTGACCAACTCCATGCCGGACATGCTGCTATC
CAAGGCTGACGACTCGCACAGTTACCAGAGCATCGACAAAATCAACCTGA
ACTCGCCCAGCAACTCTGATCTGACGCAGAGCACCCAGGAACTGGCCAAC
GAGCTGGAGCTGGACAACGAGCCGGTGCGGGAGCTGCCCCACGATGGCTA
CGAACAGCTCTTCGCTAACAATCGCAACCAGGAGCACCCGGCCGAACAAT
ATGACGACGAGCAGCTGGACAACCGACCGATGAAGGAGGTGCGCTTTCAC
AGCGTCCAGGACACTATGTCGCGCTCAAAGAGCTACACGGATAACTCCAA
TGCCCGGCGGCGGAGGAGGCGTCGCAACCAGTCGCGCAGCTCCTCGGAGA
TGCAGATCAACCAAACGAACCTCCGCCTGCACAACGCACAAACGCAGGTG
GGAACGACTCCCCTCAATCTGCTAAACAATCTGGACAACTGCGACGTGGC
CAGCATCTGCTCCACCTGCTCATCCAGCTCCTCGAGCGACATGGACGACT
ACGTATACCGCCTGCCTGCGCGGAAACACTACGGCGGAGTGAGAGTGGCC
TATGTGCCCAACGATGCGTTGGCCTATGAGCGCAAGAAGAAGATGGCCCA
GGACTCGTCCCTGGCCCCCGGGGCAGGCAATGCATCCGTGGGCGGGGCAC
CGGCGATCATGCACGAGAGCAAGAACTGCACGATTTCCTGACCACCCCCC
GTGCTGCCACCCCCGCCCTTCAACCTGAGCAGCTACTACATCCTGGACAC
GATCCTGGAGGAGCAGAGTCTGATGCTGCCGGAGAAGAAGCCTGGCTGCC
TGAGGAGGGTGTGGAACTTCTTTGGGCTCGGCAAGCCCCGCCACTCCAAC
TCCCAGCACAGCAGCAACGGAAGGCTATACAGCGTGTAGCTGTGGAATGA
GGTTTAAGAAAGGTGTTTTTAGCACGGTTGCCAACAAAGGTTGTTCCATT
AACTACAAAAGATTAGTTCTTCAGAACACTTTTTAAAAATGTACATATAT
ACAGATGGGGTAAGCCGTGTTTTTTAAAAATATATCTTTTTAATGGCAAC
CGTGGCTGTAAATAACATATCGTCATGTATAATACACTTAATAAGAAGGC
ACATATGAGATCAGAGATGAGAGAAATCGTTGTACAAAGCTGAGACTATA
TCATATTTGCATATTCATATACACATGCCCAGTCGGGGGCATTACCATAG
GTATAAGTTATTCTAGAGCTAGATTAGGCGAACAAAACAAACGAAAAGTA
GAGACCACAAACAACAAACAACGCAATCAACGAACAATAAACTCCAACGA
AATCCTATCGAAGGCCAACAAAAGAATCTCCGAAAGAGTGAAAATATTAT
TTGTTTCAGATCTTAGCCAAATGTGCAATAATTTAAAATGGCAACGCAGA
ACGCGAAATTAACTCTTCCACCAGCAAAGCGAAACGCAGAGATGTAAAAC
CATTAGCATTTGCCACATTTGCGGCTTCTTGTCTTCGAATATTTTGTTAA
TCAATTCGAATTGAAGATTCTTTTGTTTGAGAGTCAAATGTTTTATGTAA
TTTGCGTGCTTTCTCCGCGGCGTGAAAGGGAAATTGTTATATAAAAGCAT
GTGTCCAGAATACGTTTGTAACCAACCAGTGAGAGTTAAACGAAATCTTA
TTTCTAAGCTATGCTATATCAACAAGTGTGTATGGAAACATAATCAAAAG
TAAAATATATGTCTGTGTATTTTATTCTTACCAAAAAAAAAAAAAAAA

FI01027.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
esn-RA 4041 esn-RA 58..4041 1..3984 19875 99.9 Plus
esn-RB 4296 esn-RB 767..4296 455..3984 17605 99.9 Plus
pk.a 5223 pk.a 2857..3205 1538..1886 1085 87.3 Plus
pk.a 5223 pk.a 2276..2528 987..1239 590 82.2 Plus
pk.a 5223 pk.a 2677..2814 1388..1525 300 81.1 Plus
pk.a 5223 pk.a 4549..4614 2777..2842 165 83.3 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3012818..3015274 1524..3980 12240 99.9 Plus
chr2R 21145070 chr2R 3005828..3006396 512..1080 2815 99.6 Plus
chr2R 21145070 chr2R 2985973..2986427 1..455 2275 100 Plus
chr2R 21145070 chr2R 3108378..3108726 1538..1886 1130 88.3 Plus
chr2R 21145070 chr2R 3012395..3012599 1321..1525 1025 100 Plus
chr2R 21145070 chr2R 3007940..3008068 1193..1321 645 100 Plus
chr2R 21145070 chr2R 3007223..3007342 1076..1195 600 100 Plus
chr2R 21145070 chr2R 2992941..2993005 455..519 325 100 Plus
chr2R 21145070 chr2R 3108104..3108241 1388..1525 300 81.2 Plus
chr2R 21145070 chr2R 3096847..3096940 987..1080 275 86.2 Plus
chr2R 21145070 chr2R 3106409..3106528 1076..1195 225 79.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
esn-RD 2556 CG43722-PD 1..2556 584..3139 12765 100 Plus
esn-RC 3405 CG43722-PC 984..3405 520..2941 12095 100 Plus
esn-RA 2358 CG43722-PA 1..2358 584..2941 11775 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:04:47 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
esn-RD 3982 CG43722-RD 1..3980 1..3980 19870 99.9 Plus
esn-RA 3982 CG43722-RA 1..3980 1..3980 19870 99.9 Plus
esn-RB 4292 CG43722-RB 765..4290 455..3980 17600 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
esn-PD 851 CG43722-PD 15..851 626..3136 3884 99.9 Plus
esn-PC 1134 CG43722-PC 329..1134 521..2938 3696 100 Plus
esn-PA 785 CG43722-PA 15..785 626..2938 3594 100 Plus
esn-PB 785 CG43722-PB 15..785 626..2938 3594 100 Plus
pk-PA 963 CG11084-PA 136..489 851..1915 1452 74.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7125410..7127870 1524..3984 12260 99.9 Plus
2R 25286936 2R 7118409..7118977 512..1080 2830 99.8 Plus
2R 25286936 2R 7098558..7099012 1..455 2275 100 Plus
2R 25286936 2R 7221014..7221362 1538..1886 1085 87.4 Plus
2R 25286936 2R 7124987..7125191 1321..1525 1025 100 Plus
2R 25286936 2R 7120524..7120652 1193..1321 645 100 Plus
2R 25286936 2R 7119803..7119922 1076..1195 600 100 Plus
2R 25286936 2R 7105547..7105611 455..519 325 100 Plus
2R 25286936 2R 7220740..7220877 1388..1525 300 81.2 Plus
2R 25286936 2R 7209477..7209570 987..1080 275 86.2 Plus
2R 25286936 2R 7219052..7219171 1076..1195 225 79.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7126609..7129069 1524..3984 12260 99.8 Plus
2R 25260384 2R 7119608..7120176 512..1080 2830 99.8 Plus
2R 25260384 2R 7099757..7100211 1..455 2275 100 Plus
2R 25260384 2R 7222213..7222561 1538..1886 1085 87.3 Plus
2R 25260384 2R 7126186..7126390 1321..1525 1025 100 Plus
2R 25260384 2R 7121723..7121851 1193..1321 645 100 Plus
2R 25260384 2R 7121002..7121121 1076..1195 600 100 Plus
2R 25260384 2R 7106746..7106810 455..519 325 100 Plus
2R 25260384 2R 7221939..7222076 1388..1525 300 81.1 Plus
2R 25260384 2R 7210676..7210769 987..1080 275 86.1 Plus
2R 25260384 2R 7220251..7220370 1076..1195 225 79.1 Plus
2R 25260384 2R 7223905..7223970 2777..2842 165 83.3 Plus
Blast to na_te.dros performed on 2014-11-27 07:11:06 has no hits.

FI01027.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:40:08 Download gff for FI01027.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3012820..3015276 1526..3982 99   Plus
chr2R 3012396..3012599 1322..1525 100 -> Plus
chr2R 3007940..3008068 1193..1321 100 -> Plus
chr2R 3007226..3007339 1079..1192 100 -> Plus
chr2R 3005836..3006394 520..1078 99 -> Plus
chr2R 2992942..2993005 456..519 100 -> Plus
chr2R 2985973..2986427 1..455 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:44:16 Download gff for FI01027.complete
Subject Subject Range Query Range Percent Splice Strand
esn-RA 1..2358 584..2941 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:05:45 Download gff for FI01027.complete
Subject Subject Range Query Range Percent Splice Strand
esn-RA 1..2358 584..2941 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:54:31 Download gff for FI01027.complete
Subject Subject Range Query Range Percent Splice Strand
esn-RD 1..2556 584..3139 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:13:48 Download gff for FI01027.complete
Subject Subject Range Query Range Percent Splice Strand
esn-RA 1..2358 584..2941 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:40:08 Download gff for FI01027.complete
Subject Subject Range Query Range Percent Splice Strand
esn-RD 1..2556 584..3139 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:44:15 Download gff for FI01027.complete
Subject Subject Range Query Range Percent Splice Strand
esn-RA 1..3982 1..3982 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:05:45 Download gff for FI01027.complete
Subject Subject Range Query Range Percent Splice Strand
esn-RA 1..3982 1..3982 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:54:31 Download gff for FI01027.complete
Subject Subject Range Query Range Percent Splice Strand
esn-RA 1..3982 1..3982 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:13:48 Download gff for FI01027.complete
Subject Subject Range Query Range Percent Splice Strand
esn-RA 1..3982 1..3982 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:40:08 Download gff for FI01027.complete
Subject Subject Range Query Range Percent Splice Strand
esn-RA 1..3982 1..3982 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:40:08 Download gff for FI01027.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7125412..7127868 1526..3982 99   Plus
2R 7124988..7125191 1322..1525 100 -> Plus
2R 7120524..7120652 1193..1321 100 -> Plus
2R 7119806..7119919 1079..1192 100 -> Plus
2R 7118417..7118975 520..1078 100 -> Plus
2R 7105548..7105611 456..519 100 -> Plus
2R 7098558..7099012 1..455 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:54:31 Download gff for FI01027.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3012917..3015373 1526..3982 99   Plus
arm_2R 3012493..3012696 1322..1525 100 -> Plus
arm_2R 3008029..3008157 1193..1321 100 -> Plus
arm_2R 3007311..3007424 1079..1192 100 -> Plus
arm_2R 3005922..3006480 520..1078 100 -> Plus
arm_2R 2993053..2993116 456..519 100 -> Plus
arm_2R 2986063..2986517 1..455 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:39:23 Download gff for FI01027.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7126611..7129067 1526..3982 99   Plus
2R 7126187..7126390 1322..1525 100 -> Plus
2R 7121723..7121851 1193..1321 100 -> Plus
2R 7121005..7121118 1079..1192 100 -> Plus
2R 7119616..7120174 520..1078 100 -> Plus
2R 7106747..7106810 456..519 100 -> Plus
2R 7099757..7100211 1..455 100 -> Plus

FI01027.pep Sequence

Translation from 583 to 2940

> FI01027.pep
MQQAPQQQQHPHPPSSSYYTQTESELLQIEAGGTGLTFASHSQRPESAIS
QVASTAHLDVPSAASSGSGGSAVSGGSGGAPESAGRFVSPLQRRHCQPPS
HLPLNSVASPLRTASYKSAAAVAGHGFHHSHHQQLDFQRNSQSDDDSGCA
LEEYTWVPPGLRPDQVRLYFSQLPDDKVPYVNSPGEKYRVKQLLHQLPPQ
DNEVRYCHSLSDEERKELRIFSAQRKREALGRGAVRLLSDERPCKGCEEP
LSGGDIVVFAQRLGAQLCWHPGCFVCSVCKELLVDLIYFQRDGNLYCGRH
HAETQKPRCSACDEIIFSDECTEAEGRTWHMKHFACQECEHQLGGQRYIM
REGKPYCLACFDTMFAEYCDYCGEVIGVDQGQMSHDGQHWHATDQCFSCC
TCRCSLLGRPFLPRRGTIYCSIACSKGEPPTPSDTSSGPQLRPTHRASTS
SQIAKSPRRGGERERDPGRKAHHGHPKATGSAGDLLERQERQRMEAAGVA
DLLLGGGVPGMPRPAHPPPIDLTELGISLDNICAGDKSIFGDTQTLTNSM
PDMLLSKADDSHSYQSIDKINLNSPSNSDLTQSTQELANELELDNEPVRE
LPHDGYEQLFANNRNQEHPAEQYDDEQLDNRPMKEVRFHSVQDTMSRSKS
YTDNSNARRRRRRRNQSRSSSEMQINQTNLRLHNAQTQVGTTPLNLLNNL
DNCDVASICSTCSSSSSSDMDDYVYRLPARKHYGGVRVAYVPNDALAYER
KKKMAQDSSLAPGAGNASVGGAPAIMHESKNCTIS*

FI01027.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 00:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12696-PA 799 GF12696-PA 18..799 15..785 3295 87.4 Plus
Dana\GF12702-PA 1137 GF12702-PA 531..710 135..314 821 78.9 Plus
Dana\GF11783-PA 817 GF11783-PA 628..813 244..426 434 46 Plus
Dana\GF23942-PA 275 GF23942-PA 81..271 132..321 354 37.2 Plus
Dana\GF15196-PA 620 GF15196-PA 364..529 244..420 272 33.3 Plus
Dana\GF12702-PA 1137 GF12702-PA 1077..1137 708..785 165 52.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 00:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23258-PA 798 GG23258-PA 24..798 15..785 3671 97.4 Plus
Dere\GG23268-PA 1326 GG23268-PA 538..839 135..436 1467 83.1 Plus
Dere\GG22194-PA 816 GG22194-PA 604..812 213..426 436 42.7 Plus
Dere\GG13588-PA 342 GG13588-PA 80..264 132..315 339 37.3 Plus
Dere\GG21635-PA 584 GG21635-PA 351..516 244..420 277 34.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 00:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21516-PA 793 GH21516-PA 4..793 14..785 3137 82.7 Plus
Dgri\GH21524-PA 1361 GH21524-PA 551..852 135..436 1473 83.1 Plus
Dgri\GH20485-PA 831 GH20485-PA 641..830 244..430 426 44.6 Plus
Dgri\GH16600-PA 273 GH16600-PA 75..259 132..315 367 40 Plus
Dgri\GH13469-PA 585 GH13469-PA 352..517 244..420 280 34.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 00:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
esn-PD 851 CG43722-PD 1..785 1..785 4224 100 Plus
esn-PC 1134 CG43722-PC 350..1134 1..785 4224 100 Plus
esn-PA 785 CG43722-PA 1..785 1..785 4224 100 Plus
esn-PB 785 CG43722-PB 1..785 1..785 4224 100 Plus
pk-PA 963 CG11084-PA 109..546 63..498 1470 63.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 00:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19485-PA 837 GI19485-PA 29..837 6..785 3114 79.2 Plus
Dmoj\GI19495-PA 968 GI19495-PA 180..480 136..436 1461 83.4 Plus
Dmoj\GI21028-PA 836 GI21028-PA 612..836 207..431 427 41.1 Plus
Dmoj\GI12446-PA 335 GI12446-PA 77..263 130..315 372 40.1 Plus
Dmoj\GI17221-PA 605 GI17221-PA 372..537 244..420 274 34.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 00:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11153-PA 732 GL11153-PA 11..732 14..785 2678 74 Plus
Dper\GL11157-PA 987 GL11157-PA 185..486 135..436 1456 82.8 Plus
Dper\GL10662-PA 816 GL10662-PA 627..816 244..430 434 45.6 Plus
Dper\GL21108-PA 639 GL21108-PA 388..553 244..420 274 33.3 Plus
Dper\GL20860-PA 340 GL20860-PA 181..331 269..420 233 35.1 Plus
Dper\GL21108-PA 639 GL21108-PA 383..494 304..420 166 34.2 Plus
Dper\GL21108-PA 639 GL21108-PA 506..639 244..366 157 27.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 00:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11840-PA 795 GA11840-PA 11..795 14..785 3402 87.7 Plus
Dpse\GA10748-PA 1353 GA10748-PA 548..849 135..436 1460 82.8 Plus
Dpse\GA19661-PA 816 GA19661-PA 627..816 244..430 434 45.6 Plus
Dpse\GA28578-PA 352 GA28578-PA 80..264 132..315 346 37.3 Plus
Dpse\GA16481-PA 632 GA16481-PA 381..546 244..420 275 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 00:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20932-PA 785 GM20932-PA 15..785 15..785 3751 98.8 Plus
Dsec\GM20940-PA 1302 GM20940-PA 519..820 135..436 1465 83.1 Plus
Dsec\GM19980-PA 816 GM19980-PA 627..812 244..426 429 45 Plus
Dsec\GM25671-PA 333 GM25671-PA 79..264 132..316 347 37.1 Plus
Dsec\GM17013-PA 581 GM17013-PA 348..513 244..420 277 34.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 00:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10458-PA 786 GD10458-PA 15..786 15..785 3763 98.7 Plus
Dsim\GD10467-PA 179 GD10467-PA 1..177 135..311 790 79.7 Plus
Dsim\GD25476-PA 816 GD25476-PA 627..812 244..426 431 45 Plus
Dsim\GD21763-PA 678 GD21763-PA 348..513 244..420 274 33.3 Plus
Dsim\GD14678-PA 339 GD14678-PA 180..330 269..420 233 35.1 Plus
Dsim\GD21763-PA 678 GD21763-PA 343..454 304..420 163 34.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 00:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15146-PA 856 GJ15146-PA 55..856 14..785 3126 81.8 Plus
Dvir\GJ15157-PA 1421 GJ15157-PA 599..900 135..436 1471 83.1 Plus
Dvir\GJ21955-PA 830 GJ21955-PA 611..830 213..431 428 41.8 Plus
Dvir\GJ12345-PA 289 GJ12345-PA 79..263 132..315 369 39.5 Plus
Dvir\GJ17978-PA 597 GJ17978-PA 364..529 244..420 277 34.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 00:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21790-PA 779 GK21790-PA 4..779 14..785 3235 84.4 Plus
Dwil\GK21795-PA 1368 GK21795-PA 558..859 135..436 1468 82.8 Plus
Dwil\GK23303-PA 807 GK23303-PA 618..803 244..426 416 43.6 Plus
Dwil\GK20905-PA 325 GK20905-PA 80..325 132..376 366 34.3 Plus
Dwil\GK23838-PA 630 GK23838-PA 374..539 244..420 274 33.3 Plus
Dwil\GK21795-PA 1368 GK21795-PA 1303..1353 704..753 157 69.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 00:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19108-PA 789 GE19108-PA 23..789 18..785 3608 96.5 Plus
Dyak\GE19116-PA 1308 GE19116-PA 518..819 135..436 1469 83.1 Plus
Dyak\GE14189-PA 816 GE14189-PA 615..812 228..426 429 43.4 Plus
Dyak\GE19885-PA 284 GE19885-PA 80..264 132..315 342 37.3 Plus
Dyak\GE12653-PA 581 GE12653-PA 348..513 244..420 277 34.5 Plus

FI01027.hyp Sequence

Translation from 583 to 2940

> FI01027.hyp
MQQAPQQQQHPHPPSSSYYTQTESELLQIEAGGTGLTFASHSQRPESAIS
QVASTAHLDVPSAASSGSGGSAVSGGSGGAPESAGRFVSPLQRRHCQPPS
HLPLNSVASPLRTASYKSAAAVAGHGFHHSHHQQLDFQRNSQSDDDSGCA
LEEYTWVPPGLRPDQVRLYFSQLPDDKVPYVNSPGEKYRVKQLLHQLPPQ
DNEVRYCHSLSDEERKELRIFSAQRKREALGRGAVRLLSDERPCKGCEEP
LSGGDIVVFAQRLGAQLCWHPGCFVCSVCKELLVDLIYFQRDGNLYCGRH
HAETQKPRCSACDEIIFSDECTEAEGRTWHMKHFACQECEHQLGGQRYIM
REGKPYCLACFDTMFAEYCDYCGEVIGVDQGQMSHDGQHWHATDQCFSCC
TCRCSLLGRPFLPRRGTIYCSIACSKGEPPTPSDTSSGPQLRPTHRASTS
SQIAKSPRRGGERERDPGRKAHHGHPKATGSAGDLLERQERQRMEAAGVA
DLLLGGGVPGMPRPAHPPPIDLTELGISLDNICAGDKSIFGDTQTLTNSM
PDMLLSKADDSHSYQSIDKINLNSPSNSDLTQSTQELANELELDNEPVRE
LPHDGYEQLFANNRNQEHPAEQYDDEQLDNRPMKEVRFHSVQDTMSRSKS
YTDNSNARRRRRRRNQSRSSSEMQINQTNLRLHNAQTQVGTTPLNLLNNL
DNCDVASICSTCSSSSSSDMDDYVYRLPARKHYGGVRVAYVPNDALAYER
KKKMAQDSSLAPGAGNASVGGAPAIMHESKNCTIS*

FI01027.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
esn-PD 851 CG43722-PD 1..785 1..785 4224 100 Plus
esn-PC 1134 CG43722-PC 350..1134 1..785 4224 100 Plus
esn-PA 785 CG43722-PA 1..785 1..785 4224 100 Plus
esn-PB 785 CG43722-PB 1..785 1..785 4224 100 Plus
pk-PA 963 CG11084-PA 109..546 63..498 1470 63.4 Plus