Clone FI01134 Report

Search the DGRC for FI01134

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:11
Well:34
Vector:pOT2
Associated Gene/TranscriptCG14125-RA
Protein status:FI01134.pep: gold
Sequenced Size:855

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14125 2008-04-29 Picked prior to 5.5
CG14125 2008-08-15 Release 5.9 accounting
CG14125 2008-12-18 5.12 accounting

Clone Sequence Records

FI01134.complete Sequence

855 bp assembled on 2008-05-14

GenBank Submission: BT032881

> FI01134.complete
CACCGATCGTCGCTGCAATGAAGTTGGTCTGGATGTTGATGTCCTTGCAG
CTAATGCTTTTGGCAACTGCTCTTAGTGCCAGGCAATGTGTCAAGCCAAC
TGCTTCACCAAAGCCCCCTGAGGATCCTGACGACCCCACTGATGATCCCT
GGGATCCCACAGATGACTCATCGGAGGACCCATCCGATTCGACCGATGAA
CCATGGAAGCCCACTGCTAAGCCCACAGTAGTACCAACTGAACCGCCCTC
GAACATTACATCTACTGAAAATCCATCGGAGCCAACTGAAAATCCATTGA
ATCCCACGGGAAGTCCCACCAACGACGAACCATCGGAGCCAACCGAAGAA
TCCACTGAAAATCCATCGGATCCCACAGGACAGCCCACTGGAGAAACGTC
TAATCCATCAGATCAACCCACTGACAGTCCCACAGGTCAACCGACTCAAG
AAACAACTGAAGAGACTAAAATACCGGCGGGGGAAACCACCAATGAAGGT
ACTTCGGATTCCACTGAAGAGCCCACTGGAGAACCATCAATTCCCACGCA
TGAGCCAGAAGAATCCTCGGGCGATCCATCAGATCCGACAAGTGCGACCA
CCCAGACAATTCCCAACGTGGATGCGAACGCCTCCTGTAGAGCTCATCAA
GGTGTGCAATTTCTGCCACATCCGTACGATTGTCATTTATACATACATTG
CGATGGAGATATTGGATTCATCAAGGATTGTCCAAGTGATCTGTACTGGA
ACTCGGTAAACCAGACTTGCGACAAGACCTGTGCCTAAGCAAATAAAGTA
AAGTAATGTACATAAAGTACAAATAAAATAGCATGCTCTCAAAAAAAAAA
AAAAA

FI01134.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG14125-RA 1078 CG14125-RA 229..1073 1..846 4190 99.8 Plus
CG14125.a 905 CG14125.a 91..905 25..840 4040 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11965850..11966661 25..840 3935 99.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG14125-RA 771 CG14125-PA 1..771 18..788 3855 100 Plus
CG14125-RB 792 CG14125-PB 29..792 25..788 3820 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:05:29 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG14125-RA 839 CG14125-RA 1..839 1..840 4150 99.9 Plus
CG14125-RB 860 CG14125-RB 46..860 25..840 4030 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14125-PA 256 CG14125-PA 1..256 18..785 967 100 Plus
CG14125-PB 263 CG14125-PB 8..263 18..785 955 98.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:29:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11974996..11975816 25..846 4060 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11968096..11968916 25..846 4070 99.8 Plus
Blast to na_te.dros performed 2014-11-26 21:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 13113..13152 791..830 127 85.4 Plus
TART-A 13424 TART-A 13424bp 13123..13171 787..834 115 78 Plus

FI01134.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:37:12 Download gff for FI01134.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11965850..11966661 25..840 99   Plus
chr3L 11965759..11965782 1..24 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:36:18 Download gff for FI01134.complete
Subject Subject Range Query Range Percent Splice Strand
CG14125-RA 1..771 18..788 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:55:20 Download gff for FI01134.complete
Subject Subject Range Query Range Percent Splice Strand
CG14125-RA 1..771 18..788 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:30:51 Download gff for FI01134.complete
Subject Subject Range Query Range Percent Splice Strand
CG14125-RA 1..771 18..788 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:54:27 Download gff for FI01134.complete
Subject Subject Range Query Range Percent Splice Strand
CG14125-RA 1..771 18..788 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:37:12 Download gff for FI01134.complete
Subject Subject Range Query Range Percent Splice Strand
CG14125-RA 1..771 18..788 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:19:14 Download gff for FI01134.complete
Subject Subject Range Query Range Percent Splice Strand
CG14125-RA 1..783 6..788 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:55:20 Download gff for FI01134.complete
Subject Subject Range Query Range Percent Splice Strand
CG14125-RA 1..839 1..840 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:30:51 Download gff for FI01134.complete
Subject Subject Range Query Range Percent Splice Strand
CG14125-RA 1..839 1..840 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:54:27 Download gff for FI01134.complete
Subject Subject Range Query Range Percent Splice Strand
CG14125-RA 1..783 6..788 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:12 Download gff for FI01134.complete
Subject Subject Range Query Range Percent Splice Strand
CG14125-RA 1..839 1..840 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:12 Download gff for FI01134.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11974996..11975810 25..840 99   Plus
3L 11974905..11974928 1..24 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:30:51 Download gff for FI01134.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11968096..11968910 25..840 99   Plus
arm_3L 11968005..11968028 1..24 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:32:23 Download gff for FI01134.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11968096..11968910 25..840 99   Plus
3L 11968005..11968028 1..24 100 -> Plus

FI01134.pep Sequence

Translation from 2 to 787

> FI01134.pep
PIVAAMKLVWMLMSLQLMLLATALSARQCVKPTASPKPPEDPDDPTDDPW
DPTDDSSEDPSDSTDEPWKPTAKPTVVPTEPPSNITSTENPSEPTENPLN
PTGSPTNDEPSEPTEESTENPSDPTGQPTGETSNPSDQPTDSPTGQPTQE
TTEETKIPAGETTNEGTSDSTEEPTGEPSIPTHEPEESSGDPSDPTSATT
QTIPNVDANASCRAHQGVQFLPHPYDCHLYIHCDGDIGFIKDCPSDLYWN
SVNQTCDKTCA*

FI01134.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 10:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25306-PA 237 GF25306-PA 1..237 6..261 482 54.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 10:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15547-PA 369 GG15547-PA 1..369 6..261 766 58.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14125-PA 256 CG14125-PA 1..256 6..261 1420 100 Plus
CG14125-PB 263 CG14125-PB 8..263 6..261 1408 98.8 Plus
Muc68E-PA 1799 CG33265-PA 1422..1668 33..256 219 28.8 Plus
Mur89F-PC 2158 CG4090-PC 1616..1855 37..257 214 32.4 Plus
Mur89F-PB 2159 CG4090-PB 1616..1855 37..257 214 32.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 10:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11739-PA 343 GI11739-PA 114..343 59..261 265 40.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 10:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25112-PA 355 GL25112-PA 4..213 8..234 346 42.2 Plus
Dper\GL15114-PA 187 GL15114-PA 19..186 93..260 323 45 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 10:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12775-PA 240 GA12775-PA 4..239 8..260 413 41.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 10:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25314-PA 255 GM25314-PA 1..255 6..261 900 93.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 10:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14346-PA 255 GD14346-PA 1..255 6..261 941 91.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 10:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16932-PA 212 GK16932-PA 154..212 203..261 234 66.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 10:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21869-PA 255 GE21869-PA 1..255 6..261 672 78.1 Plus

FI01134.hyp Sequence

Translation from 2 to 787

> FI01134.hyp
PIVAAMKLVWMLMSLQLMLLATALSARQCVKPTASPKPPEDPDDPTDDPW
DPTDDSSEDPSDSTDEPWKPTAKPTVVPTEPPSNITSTENPSEPTENPLN
PTGSPTNDEPSEPTEESTENPSDPTGQPTGETSNPSDQPTDSPTGQPTQE
TTEETKIPAGETTNEGTSDSTEEPTGEPSIPTHEPEESSGDPSDPTSATT
QTIPNVDANASCRAHQGVQFLPHPYDCHLYIHCDGDIGFIKDCPSDLYWN
SVNQTCDKTCA*

FI01134.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG14125-PA 256 CG14125-PA 1..256 6..261 1420 100 Plus
CG14125-PB 263 CG14125-PB 8..263 6..261 1408 98.8 Plus
Muc68E-PA 1799 CG33265-PA 1422..1668 33..256 219 28.8 Plus
Mur89F-PC 2158 CG4090-PC 1616..1855 37..257 214 32.4 Plus
Mur89F-PB 2159 CG4090-PB 1616..1855 37..257 214 32.4 Plus