Clone FI01405 Report

Search the DGRC for FI01405

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:5
Vector:pFlc-1
Associated Gene/TranscriptCG11155-RA
Protein status:FI01405.pep: gold
Sequenced Size:3003

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11155 2008-12-18 5.12 accounting

Clone Sequence Records

FI01405.complete Sequence

3003 bp assembled on 2008-09-23

GenBank Submission: BT044556.1

> FI01405.complete
ATTAGTGGTGCTTTTTTCTTTCCATCAACTGGTATTCGGTTATCCGTGTT
AAACAAATATCTAAATTTTATATATTGTATATTATATAAATAAATTATAA
CTAAGTGTTTCGGAATGTAATTAAGCAGCATTATCCACATAAAATAATGG
TACGAAAAAAACGAGAAATCGTAATAAAGGAAAATATTCAAGGACGAAGT
TACCTTAAAAAAATATGTTGTTCGTATATAATACTGTCCATCCTCGTAAT
TTCTAATGCCTTGCCCCCAGTAATACGAGTAGGTGCCATATTTACGGAAG
ATGAACGCGAAAGCAGTATTGAATCTGCATTTAAATACGCAATATACCGT
ATAAATAAGGAAAAGACTCTTCTTCCCAATACACAATTGGTTTACGATAT
TGAGTATGTTCCCCGAGATGACTCGTTTCGCACTACTAAAAAGGTTTGCA
GTCAGTTGGAAGCAGGTGTTCAAGCAATTTTTGGCCCAACAGATGCTCTT
TTAGCTAGTCATGTACAATCCATATGCGAAGCATATGATATACCCCATAT
TGAAGGTCGAATTGACCTCGAATATAATTCTAAAGAATTTTCTATAAATT
TATATCCGTCGCATACGCTCTTAACTCTAGCATATAGAGATATAATGGTA
TATTTGAACTGGACGAAGGTGGCAATAATTTATGAAGAAGATTATGGTCT
ATTTAATTTGATGCACTCATCAACTGAGACGAAAGCGGAAATGTATATAA
GGCAAGCAAGTCCGGATTCCTATCGCCAAGTTTTACGAGCGATACGTCAA
AAGGAAATTTACAAAATAATAGTGGATACAAATCCGTCCCATATAAAATC
GTTTTTTAGATCCATTTTGCAACTACAAATGAATGACCATCGTTACCATT
ATATGTTTACAACATTCGACTTGGAGACATATGATCTGGAAGATTTCAGA
TATAACAGCGTAAATATAACTGCATTTCGGCTGGTAGATGTCGATAGCAA
AAGATATCTCGAAGTAATTAATCAAATGCAGAAATTACAACACAATGGAT
TGGACACTATAAATGGAAGTCCTTATATACAGACGGAGTCCGCATTAATG
TTTGATTCGGTGTACGCGTTTGCGAATGGACTACACTTTCTAAATTTGGA
TAATCACCAAAATTTTTATATCAAAAACCTATCCTGCACCTCCGACCAAA
CCTGGAATGATGGAATTTCATTGTATAACCAAATAAATGCAGCCATCACA
GACGGACTGACTGGCACTGTCCAATTTGTGGAAGGTCGGCGAAACATATT
TAAGCTTGATATTCTTAAACTAAAGCAAGAAAAAATACAAAAGGTTGGAT
ATTGGCATCCCGACGACGGTGTTAACATTTCGGATCCAACAGCTTTCTAC
GATTCAAATATCGCAAATATAACCTTGGTCGTTATGACTAGAGAGGAGCG
GCCGTATGTTATGGTTAAAGAAGACAAAAATCTAACTGGAAATTTGAGGT
TTGAAGGATTTTGTATTGATCTTTTAAAAGCAATCGCCACACAAGTTGGG
TTTCAATATAAAATTGAATTAGTTCCCGATAATATGTACGGTGTTTACAT
ACCAGAGACTAATTCATGGAATGGAATCGTGCAGGAATTAATGGAAAGGC
GTGCTGATCTTGCTGTAGCCTCAATGACAATTAATTATGCTCGGGAAAGT
GTTATCGACTTTACCAAACCATTTATGAACTTGGGCATTGGCATATTATT
CAAGGTGCCGACAAGTCAACCAACACGACTGTTCTCCTTTATGAACCCTT
TGGCAATCGAGATATGGCTTTATGTGCTAGCTGCATACATATTAGTATCT
TTCGCGCTCTTTGTAATGGCTCGATTTTCTCCATATGAGTGGAAAAACCC
CCATCCATGCTACAAGGAAACGGATATAGTGGAAAATCAGTTTTCCATAT
CAAACAGTTTTTGGTTTATAACAGGAACATTCTTACGCCAAGGATCTGGA
CTTAATCCGAAGGCAACCTCGACGCGTATTGTGGGCGGATGCTGGTTCTT
TTTTTGCCTAATCATTATATCTTCATACACTGCCAACTTAGCTGCATTTC
TAACAGTTGAACGGATGATTTCCCCCATTGAAAGCGCTTCTGATTTGGCA
GAGCAAACCGAAATATCATATGGAACTTTGGAAGGTGGATCGACAATGAC
ATTTTTTAGGGATTCAAAAATTGGTATATATCAAAAAATGTGGCGTTATA
TGGAAAACCGTAAAACAGCTGTATTTGTAAAAACCTATGAAGACGGAATT
AAACGAGTAATGGAAGGAAGCTATGCTTTTTTGATGGAATCGACAATGCT
GGACTATGCTGTTCAACGTGATTGTAATCTGACCCAAATAGGAGGCCTTC
TTGATTCTAAAGGTTATGGTATCGCAACACCCAAGGGCTCTCCATGGAGA
GATAAAATATCACTTGCTATTTTAGAGCTTCAAGAAAAGGGTATTATTCA
AATATTATATGACAAATGGTGGAAAAATACAGGTGACGTTTGCAACAGAG
ATGATAAGAGCAAGGAGTCCAAAGCCAATGCACTTGGAGTAGAAAATATT
GGTGGCGTGTTTGTTGTTCTCCTTTGTGGACTTGCGCTTGCAGTTGTTGT
AGCCATATTTGAGTTTTGCTGGAATTCTAGAAAAAATTTAAATACTGAAA
ATCAATCTCTGTGTTCAGAAATGGCAGAGGAACTTCGTTTTGCAATGCAC
TGCCATGGTTCAAAATCAAGACATAGACCGCGAAAACGAAGTTGCCTTAA
TTGTTCGTCTGTACCAACATATGTTCCGAGTAATGTGAGCACGTCAAATG
TGGGCGTTTACTATAATTACTTTAATTAACTTTTACCATGCTTTAACACG
TTTATTCAAACAAAACAAATATAGTTTTTTCTACAATTTGTAATGACATT
ATTACTATATAAATAATATGCAATTTTAAAAAAAAAGAAAAAAAAAAAAA
AAA

FI01405.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG11155.e 3925 CG11155.e 238..3219 1..2982 14910 100 Plus
CG11155-RA 3350 CG11155-RA 238..3219 1..2982 14910 100 Plus
CG11155.f 4644 CG11155.f 238..3219 1..2982 14910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr4 1351717 chr4 1147485..1147902 281..698 2090 100 Plus
chr4 1351717 chr4 1155573..1155971 2205..2603 1965 99.5 Plus
chr4 1351717 chr4 1156023..1156404 2601..2982 1910 100 Plus
chr4 1351717 chr4 1152184..1152444 1753..2013 1305 100 Plus
chr4 1351717 chr4 1151676..1151881 1444..1649 1030 100 Plus
chr4 1351717 chr4 1150868..1151072 1242..1446 1025 100 Plus
chr4 1351717 chr4 1154358..1154558 2011..2211 1005 100 Plus
chr4 1351717 chr4 1148973..1149140 696..863 840 100 Plus
chr4 1351717 chr4 1150051..1150215 918..1082 825 100 Plus
chr4 1351717 chr4 1150508..1150669 1081..1242 810 100 Plus
chr4 1351717 chr4 1147089..1147240 1..152 760 100 Plus
chr4 1351717 chr4 1147293..1147428 149..284 680 100 Plus
chr4 1351717 chr4 1151973..1152080 1649..1756 540 100 Plus
chr4 1351717 chr4 1149920..1149974 864..918 275 100 Plus
chr4 1351717 chr4 659651..659767 2527..2411 270 82.1 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG11155-RD 2733 CG11155-PD 1..2733 147..2879 13665 100 Plus
CG11155-RA 2733 CG11155-PA 1..2733 147..2879 13665 100 Plus
CG11155-RB 2568 CG11155-PB 1..1866 147..2012 9330 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:05:47 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:34:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG11155-RD 4984 CG11155-RD 3..2984 1..2982 14910 100 Plus
CG11155-RA 2979 CG11155-RA 3..2979 1..2977 14885 100 Plus
CG11155-RB 3644 CG11155-RB 3..2014 1..2012 10060 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG11155-PD 910 CG11155-PD 1..910 147..2876 4654 100 Plus
CG11155-PA 910 CG11155-PA 1..910 147..2876 4654 100 Plus
CG11155-PB 855 CG11155-PB 1..622 147..2012 3239 100 Plus
CG9935-PB 899 CG9935-PB 3..889 213..2807 2394 53.7 Plus
CG9935-PD 898 CG9935-PD 3..888 213..2807 2381 53.7 Plus
CG11155-PB 855 CG11155-PB 758..855 1929..2222 427 81.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 1127000..1127417 281..698 2090 100 Plus
4 1348131 4 1135088..1135486 2205..2603 1980 99.7 Plus
4 1348131 4 1135538..1135919 2601..2982 1910 100 Plus
4 1348131 4 1131699..1131959 1753..2013 1305 100 Plus
4 1348131 4 1131191..1131396 1444..1649 1030 100 Plus
4 1348131 4 1130383..1130587 1242..1446 1025 100 Plus
4 1348131 4 1133873..1134073 2011..2211 1005 100 Plus
4 1348131 4 1128488..1128655 696..863 840 100 Plus
4 1348131 4 1129566..1129730 918..1082 825 100 Plus
4 1348131 4 1130023..1130184 1081..1242 810 100 Plus
4 1348131 4 1126604..1126755 1..152 760 100 Plus
4 1348131 4 1126808..1126943 149..284 680 100 Plus
4 1348131 4 1131488..1131595 1649..1756 540 100 Plus
4 1348131 4 1129435..1129489 864..918 275 100 Plus
4 1348131 4 639089..639205 2527..2411 270 82.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:27:05
Subject Length Description Subject Range Query Range Score Percent Strand
4 1331231 4 1127000..1127417 281..698 2090 100 Plus
4 1331231 4 1135088..1135486 2205..2603 1980 99.7 Plus
4 1331231 4 1135538..1135919 2601..2982 1910 100 Plus
4 1331231 4 1131699..1131959 1753..2013 1305 100 Plus
4 1331231 4 1131191..1131396 1444..1649 1030 100 Plus
4 1331231 4 1130383..1130587 1242..1446 1025 100 Plus
4 1331231 4 1133873..1134073 2011..2211 1005 100 Plus
4 1331231 4 1128488..1128655 696..863 840 100 Plus
4 1331231 4 1129566..1129730 918..1082 825 100 Plus
4 1331231 4 1130023..1130184 1081..1242 810 100 Plus
4 1331231 4 1126604..1126755 1..152 760 100 Plus
4 1331231 4 1126808..1126943 149..284 680 100 Plus
4 1331231 4 1131488..1131595 1649..1756 540 100 Plus
4 1331231 4 1129435..1129489 864..918 275 100 Plus
4 1331231 4 639089..639205 2527..2411 270 82 Minus
4 1331231 4 639331..639459 2414..2286 180 75.9 Minus
4 1331231 4 640105..640166 1756..1695 160 83.8 Minus
4 1331231 4 642637..642698 955..894 160 83.8 Minus
Blast to na_te.dros performed on 2014-11-27 09:34:51 has no hits.

FI01405.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:24:23 Download gff for FI01405.complete
Subject Subject Range Query Range Percent Splice Strand
chr4 1156024..1156406 2602..2987 98   Plus
chr4 1155579..1155969 2211..2601 99 -> Plus
chr4 1154360..1154557 2013..2210 100 -> Plus
chr4 1152186..1152443 1755..2012 100 -> Plus
chr4 1151974..1152078 1650..1754 100 -> Plus
chr4 1151678..1151881 1446..1649 100 -> Plus
chr4 1150868..1151071 1242..1445 100 -> Plus
chr4 1150510..1150668 1083..1241 100 -> Plus
chr4 1150051..1150215 918..1082 100 -> Plus
chr4 1149920..1149973 864..917 100 -> Plus
chr4 1148974..1149140 697..863 100 -> Plus
chr4 1147487..1147900 283..696 100 -> Plus
chr4 1147294..1147426 150..282 100 -> Plus
chr4 1147089..1147237 1..149 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:37:01 Download gff for FI01405.complete
Subject Subject Range Query Range Percent Splice Strand
CG11155-RA 1..2733 147..2879 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:13:09 Download gff for FI01405.complete
Subject Subject Range Query Range Percent Splice Strand
CG11155-RA 1..2733 147..2879 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:30:19 Download gff for FI01405.complete
Subject Subject Range Query Range Percent Splice Strand
CG11155-RA 1..2733 147..2879 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:24:23 Download gff for FI01405.complete
Subject Subject Range Query Range Percent Splice Strand
CG11155-RA 1..2733 147..2879 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:51:04 Download gff for FI01405.complete
Subject Subject Range Query Range Percent Splice Strand
CG11155-RA 1..2981 4..2984 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:13:09 Download gff for FI01405.complete
Subject Subject Range Query Range Percent Splice Strand
CG11155-RA 1..2981 4..2984 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:30:19 Download gff for FI01405.complete
Subject Subject Range Query Range Percent Splice Strand
CG11155-RD 3..2986 1..2987 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 15:42:09 Download gff for FI01405.complete
Subject Subject Range Query Range Percent Splice Strand
CG11155-RA 1..2981 4..2984 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:24:23 Download gff for FI01405.complete
Subject Subject Range Query Range Percent Splice Strand
CG11155-RD 3..2986 1..2987 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:24:23 Download gff for FI01405.complete
Subject Subject Range Query Range Percent Splice Strand
4 1135539..1135921 2602..2987 98   Plus
4 1135094..1135484 2211..2601 100 -> Plus
4 1133875..1134072 2013..2210 100 -> Plus
4 1131701..1131958 1755..2012 100 -> Plus
4 1131489..1131593 1650..1754 100 -> Plus
4 1131193..1131396 1446..1649 100 -> Plus
4 1130383..1130586 1242..1445 100 -> Plus
4 1130025..1130183 1083..1241 100 -> Plus
4 1129566..1129730 918..1082 100 -> Plus
4 1129435..1129488 864..917 100 -> Plus
4 1128489..1128655 697..863 100 -> Plus
4 1127002..1127415 283..696 100 -> Plus
4 1126809..1126941 150..282 100 -> Plus
4 1126604..1126752 1..149 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:30:19 Download gff for FI01405.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 1156165..1156547 2602..2987 98   Plus
arm_4 1155720..1156110 2211..2601 100 -> Plus
arm_4 1154501..1154698 2013..2210 100 -> Plus
arm_4 1152327..1152584 1755..2012 100 -> Plus
arm_4 1152115..1152219 1650..1754 100 -> Plus
arm_4 1151819..1152022 1446..1649 100 -> Plus
arm_4 1151009..1151212 1242..1445 100 -> Plus
arm_4 1150651..1150809 1083..1241 100 -> Plus
arm_4 1150192..1150356 918..1082 100 -> Plus
arm_4 1150061..1150114 864..917 100 -> Plus
arm_4 1149115..1149281 697..863 100 -> Plus
arm_4 1147628..1148041 283..696 100 -> Plus
arm_4 1147435..1147567 150..282 100 -> Plus
arm_4 1147230..1147378 1..149 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:43:44 Download gff for FI01405.complete
Subject Subject Range Query Range Percent Splice Strand
4 1135539..1135921 2602..2987 98   Plus
4 1135094..1135484 2211..2601 100 -> Plus
4 1133875..1134072 2013..2210 100 -> Plus
4 1131701..1131958 1755..2012 100 -> Plus
4 1131489..1131593 1650..1754 100 -> Plus
4 1131193..1131396 1446..1649 100 -> Plus
4 1130383..1130586 1242..1445 100 -> Plus
4 1130025..1130183 1083..1241 100 -> Plus
4 1129566..1129730 918..1082 100 -> Plus
4 1129435..1129488 864..917 100 -> Plus
4 1128489..1128655 697..863 100 -> Plus
4 1127002..1127415 283..696 100 -> Plus
4 1126809..1126941 150..282 100 -> Plus
4 1126604..1126752 1..149 100 -> Plus

FI01405.pep Sequence

Translation from 146 to 2878

> FI01405.pep
MVRKKREIVIKENIQGRSYLKKICCSYIILSILVISNALPPVIRVGAIFT
EDERESSIESAFKYAIYRINKEKTLLPNTQLVYDIEYVPRDDSFRTTKKV
CSQLEAGVQAIFGPTDALLASHVQSICEAYDIPHIEGRIDLEYNSKEFSI
NLYPSHTLLTLAYRDIMVYLNWTKVAIIYEEDYGLFNLMHSSTETKAEMY
IRQASPDSYRQVLRAIRQKEIYKIIVDTNPSHIKSFFRSILQLQMNDHRY
HYMFTTFDLETYDLEDFRYNSVNITAFRLVDVDSKRYLEVINQMQKLQHN
GLDTINGSPYIQTESALMFDSVYAFANGLHFLNLDNHQNFYIKNLSCTSD
QTWNDGISLYNQINAAITDGLTGTVQFVEGRRNIFKLDILKLKQEKIQKV
GYWHPDDGVNISDPTAFYDSNIANITLVVMTREERPYVMVKEDKNLTGNL
RFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELME
RRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMN
PLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFS
ISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAA
FLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWR
YMENRKTAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQRDCNLTQIGG
LLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWKNTGDVCN
RDDKSKESKANALGVENIGGVFVVLLCGLALAVVVAIFEFCWNSRKNLNT
ENQSLCSEMAEELRFAMHCHGSKSRHRPRKRSCLNCSSVPTYVPSNVSTS
NVGVYYNYFN*

FI01405.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 19:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15914-PA 610 GF15914-PA 1..457 167..624 2149 86.5 Plus
Dana\GF17009-PA 853 GF17009-PA 22..840 35..846 1826 44.3 Plus
Dana\GF17996-PA 968 GF17996-PA 21..864 29..866 1516 37.7 Plus
Dana\GF14315-PA 1018 GF14315-PA 2..861 23..866 1389 36 Plus
Dana\GF15915-PA 254 GF15915-PA 1..254 657..910 1273 90.6 Plus
Dana\GF15914-PA 610 GF15914-PA 442..518 523..598 171 44.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 19:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16408-PA 909 GG16408-PA 1..456 167..622 2387 96.9 Plus
Dere\GG16440-PA 669 GG16440-PA 3..666 23..688 1847 52.4 Plus
Dere\GG15059-PA 853 GG15059-PA 23..840 36..846 1816 44.1 Plus
Dere\GG16408-PA 909 GG16408-PA 594..909 595..910 1620 92.7 Plus
Dere\GG24232-PA 960 GG24232-PA 44..857 55..866 1460 37.9 Plus
Dere\GG21289-PA 1000 GG21289-PA 12..859 37..866 1393 36.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 19:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23957-PA 1045 GH23957-PA 1..592 32..622 2777 86.7 Plus
Dgri\GH13546-PA 856 GH13546-PA 3..853 59..886 2523 56.1 Plus
Dgri\GH17276-PA 858 GH17276-PA 30..845 38..846 1822 44.7 Plus
Dgri\GH23957-PA 1045 GH23957-PA 730..1045 595..910 1510 86.8 Plus
Dgri\GH18377-PA 959 GH18377-PA 35..908 45..872 1476 36.1 Plus
Dgri\GH10703-PA 1000 GH10703-PA 14..847 45..867 1382 36.3 Plus
Dgri\GH23957-PA 1045 GH23957-PA 579..644 523..588 171 48.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG11155-PD 910 CG11155-PD 1..910 1..910 4757 100 Plus
CG11155-PA 910 CG11155-PA 1..910 1..910 4757 100 Plus
CG11155-PB 855 CG11155-PB 1..622 1..622 3239 100 Plus
CG9935-PB 899 CG9935-PB 3..889 23..887 2472 53.7 Plus
CG9935-PD 898 CG9935-PD 3..888 23..887 2459 53.7 Plus
CG11155-PB 855 CG11155-PB 758..855 595..692 427 81.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 19:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14037-PA 1027 GI14037-PA 1..592 32..622 2776 86 Plus
Dmoj\GI22149-PA 859 GI22149-PA 31..846 38..846 1814 44.4 Plus
Dmoj\GI14037-PA 1027 GI14037-PA 579..1027 523..910 1600 68.4 Plus
Dmoj\GI10783-PA 969 GI10783-PA 42..859 45..866 1482 38.1 Plus
Dmoj\GI11269-PA 1011 GI11269-PA 25..858 45..867 1410 37.1 Plus
Dmoj\GI19094-PA 474 GI19094-PA 19..472 239..690 1405 58.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 19:49:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18180-PA 895 GL18180-PA 6..856 25..882 2532 56.5 Plus
Dper\GL23254-PA 858 GL23254-PA 28..845 36..846 1805 44 Plus
Dper\GL18376-PA 711 GL18376-PA 2..320 305..622 1544 90.6 Plus
Dper\GL24289-PA 952 GL24289-PA 18..848 32..866 1483 37.3 Plus
Dper\GL26648-PA 997 GL26648-PA 2..837 45..867 1336 37 Plus
Dper\GL18376-PA 711 GL18376-PA 307..711 523..910 1280 62.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 19:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27978-PA 476 GA27978-PA 1..471 32..501 2223 87.7 Plus
Dpse\GA22545-PA 681 GA22545-PA 25..680 98..756 1958 56.5 Plus
Dpse\GA17711-PA 858 GA17711-PA 28..845 36..846 1810 44.1 Plus
Dpse\GA26558-PA 952 GA26558-PA 18..848 32..866 1488 37.4 Plus
Dpse\GA26558-PB 788 GA26558-PB 18..785 32..800 1423 38.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 19:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13027-PA 1072 GM13027-PA 1..621 2..622 3253 97.3 Plus
Dsec\GM26773-PA 899 GM26773-PA 3..889 23..887 2525 53.9 Plus
Dsec\GM23151-PA 853 GM23151-PA 23..840 36..846 1817 44.3 Plus
Dsec\GM13027-PA 1072 GM13027-PA 757..1072 595..910 1640 94 Plus
Dsec\GM15053-PA 956 GM15053-PA 16..853 26..866 1475 37.5 Plus
Dsec\GM23400-PA 1002 GM23400-PA 27..861 45..866 1394 36.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 19:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20025-PA 853 GD20025-PA 23..840 36..846 1782 43.8 Plus
Dsim\GD19386-PA 823 GD19386-PA 36..794 45..804 1402 38.4 Plus
Dsim\GD20046-PA 902 GD20046-PA 34..873 43..882 1271 35 Plus
Dsim\GD20047-PA 897 GD20047-PA 46..892 52..889 1219 35.3 Plus
Dsim\GD23352-PA 907 GD23352-PA 32..867 43..867 1163 33.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 19:49:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12536-PA 1072 GJ12536-PA 28..692 35..673 2776 78.9 Plus
Dvir\GJ17530-PA 757 GJ17530-PA 1..645 46..692 1880 54.4 Plus
Dvir\GJ24267-PA 858 GJ24267-PA 30..845 38..846 1826 44.6 Plus
Dvir\GJ12536-PA 1072 GJ12536-PA 756..1072 595..910 1523 86.4 Plus
Dvir\GJ14381-PA 967 GJ14381-PA 41..858 45..866 1474 38.2 Plus
Dvir\GJ12409-PA 990 GJ12409-PA 2..840 45..867 1351 36.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 19:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13656-PA 712 GK13656-PA 37..705 22..690 3192 87.7 Plus
Dwil\GK12298-PA 1021 GK12298-PA 2..828 23..847 2552 57.2 Plus
Dwil\GK22690-PA 858 GK22690-PA 5..845 16..846 1826 43.9 Plus
Dwil\GK22476-PA 888 GK22476-PA 29..849 58..879 1479 37.9 Plus
Dwil\GK15433-PA 1004 GK15433-PA 2..838 45..868 1384 36.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 19:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14568-PA 1074 GE14568-PA 1..621 2..622 3176 95 Plus
Dyak\GE14507-PA 675 GE14507-PA 3..670 23..692 1863 52.1 Plus
Dyak\GE25031-PA 853 GE25031-PA 23..840 36..846 1819 44.3 Plus
Dyak\GE14568-PA 1074 GE14568-PA 759..1074 595..910 1626 93 Plus
Dyak\GE25697-PA 901 GE25697-PA 31..855 45..872 1507 37.8 Plus
Dyak\GE11157-PA 950 GE11157-PA 31..848 45..866 1475 37.9 Plus

FI01405.hyp Sequence

Translation from 146 to 2878

> FI01405.hyp
MVRKKREIVIKENIQGRSYLKKICCSYIILSILVISNALPPVIRVGAIFT
EDERESSIESAFKYAIYRINKEKTLLPNTQLVYDIEYVPRDDSFRTTKKV
CSQLEAGVQAIFGPTDALLASHVQSICEAYDIPHIEGRIDLEYNSKEFSI
NLYPSHTLLTLAYRDIMVYLNWTKVAIIYEEDYGLFNLMHSSTETKAEMY
IRQASPDSYRQVLRAIRQKEIYKIIVDTNPSHIKSFFRSILQLQMNDHRY
HYMFTTFDLETYDLEDFRYNSVNITAFRLVDVDSKRYLEVINQMQKLQHN
GLDTINGSPYIQTESALMFDSVYAFANGLHFLNLDNHQNFYIKNLSCTSD
QTWNDGISLYNQINAAITDGLTGTVQFVEGRRNIFKLDILKLKQEKIQKV
GYWHPDDGVNISDPTAFYDSNIANITLVVMTREERPYVMVKEDKNLTGNL
RFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELME
RRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMN
PLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFS
ISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAA
FLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWR
YMENRKTAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQRDCNLTQIGG
LLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWKNTGDVCN
RDDKSKESKANALGVENIGGVFVVLLCGLALAVVVAIFEFCWNSRKNLNT
ENQSLCSEMAEELRFAMHCHGSKSRHRPRKRSCLNCSSVPTYVPSNVSTS
NVGVYYNYFN*

FI01405.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG11155-PD 910 CG11155-PD 1..910 1..910 4757 100 Plus
CG11155-PA 910 CG11155-PA 1..910 1..910 4757 100 Plus
CG11155-PB 855 CG11155-PB 1..622 1..622 3239 100 Plus
CG9935-PB 899 CG9935-PB 3..889 23..887 2472 53.7 Plus
CG9935-PD 898 CG9935-PD 3..888 23..887 2459 53.7 Plus
CG11155-PB 855 CG11155-PB 758..855 595..692 427 81.6 Plus