Clone FI01412 Report

Search the DGRC for FI01412

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:12
Vector:pFlc-1
Associated Gene/TranscriptCG9330-RA
Protein status:FI01412.pep: gold
Sequenced Size:2399

Clone Sequence Records

FI01412.complete Sequence

2399 bp assembled on 2009-03-10

GenBank Submission: BT072838.1

> FI01412.complete
AGTCGACCCAGCAACGGTCACTCTGCTATCCCCTTTAGTTTTCGTTTGCG
GTGGAATAAAAGTCGGAAAAGTCAATTAAAAGCCGACTGCCACACGTCCA
GAAAGCGAATTTGCGATCAAGGTCAAGATGAGCGAGTACACAAGCATTCT
GCAGCGCGAGTTTCCCAAAATCGACCACGAGCTGCTCACCTATGTCGTTG
GCGTGCTCACCGGAAGCGAGGAGGACTTCGAAAGCGGCGATGACATCTTC
GAAGCGGTGGGCGACATCCTGCAGAGCGTCGACTGTGATAGGTCGGAGGA
GAGTGTACGTACGCTTTGCGAGCAGTTCCTCAACATCATGAAGAACAACG
AGGTCAACGTGGAGCGAAAGGTTCTCAACGCGCCGGTCAACATCGAGGAG
ATGGCCAAGAACATGGAGCGGCTGGACAAGGATATGCAAAGCATCTGGGT
GGCCAACAAAGATGGCGCCAATAAAGTGGACTCCAAGAAACTAGGAAAGG
CGGAGGCCAAGCTGCAGCAGAAGCAGGAGAAACGGCAGGAGGTGAACAAA
CATGGTATGATTCCTGTTGCGGTGAAGCTACAAACGGCCACAGCCTCACA
GGTGACCAACAAGAAGAACACCAAGCTGGATCAGAAAGGTCTTAACCGAT
CCATGGACATCAAGATCGAAAACTTTGACCTGGCTTTTGGCGAAAAAGTT
CTTCTGCAGAATGCGAATCTGCTGCTGTCTTACGGACGCCGCTATGGTCT
GGTGGGACGCAATGGCCTGGGCAAGACTACACTGCTCCGCATGATTGCCG
AGCGACAGCTACAGATCCCTTCGCACATATCGGTGCTGCACGTGGAGCAG
GAGGTGGTTGGCGATGACACACCAGCAGTGGAGAGTGTGCTGGAATGTGA
TACTGAGCGAACGAGACTTCTGACCCGCGAGAAGGAGATTCTGGCTGCCC
TTAACAATGGAGTTCAGGATGCGACGCTGTCCAATGAGCTGAGCGAGACC
TACGCCTCTCTGCAGAACATCGAGGCGGACAAGGCTGTGGCCCGCGCATC
TGTGATACTTAAGGGCTTGGGATTCGATGCAGATATGCAGCTGCGTCCAA
CTAAATCCTTCTCAGGCGGCTGGCGCATGCGTCTTGCTTTGGCCAGGGCA
CTGTTCTCAAAACCCGATCTGTTACTGCTCGATGAGCCGACGAACATGTT
AGACATCAAAGCCATTATTTGGCTGGAAAACTATCTGCAGACATGGGCCA
CCACCATTCTGGTAGTTTCTCACGATCGCAACTTCCTGGACACGGTGCCG
ACAGACATTATTCACCTACATTCCCAGGAACTGGAGGCATACAAGGGAAA
CTATGAACAGTTCGAGAAGACCAAGACGGAGAAGCTGAAGTCCCAAAGAC
GTGAATACGAGGCCCAAATGGCTCACAGAGCTCATGTCCAAGACTTCATC
GATCGCTTCCGATACAACGCAAACCGTGCCTCGTCTGTGCAATCCAAAAT
TAAAATGCTCGAAAAGCTGCCGGAACTAAAGCCAGTGGAAAAGGAGACTG
TGGTCACGCTCAAATTCCCCGAAGTGGAACCCCTTAATCCTCCCGTGCTG
GCCATTTCGGAGGTTACTTTCCGTTACAATCCAGAAGATCCACTGCCCAT
TTTCAAGGGCGTCAATCTCTCAGCCACATCGGACTCTCGAATTTGCATTG
TCGGAGAAAACGGAGCGGGAAAGTCGACGCTGCTGAAGATTATTGTCGGT
CAACTGAGCACTATTCACGGAAACATTGTCCTGCATCGCGGTCTTCGAAT
TGGATATTTTGCGCAGCACCATGTGGACCATCTGAATATGAATGTAACGT
GTGTGGGAGTTTTGGCAGAACTGTTTCCTGGTCGCCCGGACGAAGAGTAT
CGCCGGCAGTTGGGCAGCTTCGGCATATCCGGACCACTGGCACTGCAGAG
CATTGCCAGTTTATCTGGAGGACAAAAATCACGAGTGGCCTTAGCAAAGA
TGTGCATGGCGGAGCCAAATTTCCTGGTGCTCGATGAGCCGACTAATCAC
TTGGACATTGAAACCATTGATGCTTTGGGCCGAGCCATAAATGCCTTTAA
GGGCGGCGTAATCCTGGTTTCCCACGACGAACGCCTCATTAAGGTCGTCT
GCAAGGAACTCTGGGTGTGTGGCAATCGCACAGTCAGAGCGATCGAAGGT
GGTCTGGACGAGTATAAGCGCGAGGTTTACAAGGAAATCGAAGCTAATAG
TTGAATTAAATGTAATTATTAATTACTATATTTGTGAAACAGCCTAGCAA
TAAATTTATATTATGCCTGACACAAGATGAAAATTGTATTTTCGAAAGGA
TCATAACAAATATACTCAAGTTTATTGATGGGCAAAAAAAAAAAAAAAA

FI01412.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG9330-RA 2474 CG9330-RA 23..2404 1..2382 11880 99.9 Plus
CG14100-RA 1491 CG14100-RA 1448..1491 2382..2339 220 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19576553..19577201 697..1345 3245 100 Plus
chr3L 24539361 chr3L 19577504..19577994 1519..2009 2440 99.8 Plus
chr3L 24539361 chr3L 19578210..19578492 2100..2382 1415 100 Plus
chr3L 24539361 chr3L 19575914..19576170 216..472 1285 100 Plus
chr3L 24539361 chr3L 19576271..19576494 473..696 1120 100 Plus
chr3L 24539361 chr3L 19575634..19575849 1..216 1080 100 Plus
chr3L 24539361 chr3L 19577262..19577436 1345..1519 845 98.9 Plus
chr3L 24539361 chr3L 19578060..19578153 2009..2102 470 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG9330-RA 2127 CG9330-PA 1..2127 128..2254 10605 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:05:50 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG9330-RA 2384 CG9330-RA 3..2384 1..2382 11880 99.9 Plus
CG14100-RA 1393 CG14100-RA 1354..1393 2382..2343 200 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG9330-PA 708 CG9330-PA 1..708 128..2251 3414 100 Plus
CG1703-PB 901 CG1703-PB 332..880 590..2227 1124 45.4 Plus
CG1703-PA 901 CG1703-PA 332..880 590..2227 1124 45.4 Plus
CG9281-PD 611 CG9281-PD 70..603 647..2251 1031 40.7 Plus
CG9281-PC 611 CG9281-PC 70..603 647..2251 1031 40.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19587174..19587822 697..1345 3245 100 Plus
3L 28110227 3L 19588123..19588613 1519..2009 2440 99.8 Plus
3L 28110227 3L 19588829..19589111 2100..2382 1415 100 Plus
3L 28110227 3L 19586535..19586791 216..472 1285 100 Plus
3L 28110227 3L 19586892..19587115 473..696 1120 100 Plus
3L 28110227 3L 19586255..19586470 1..216 1080 100 Plus
3L 28110227 3L 19587881..19588055 1345..1519 860 99.4 Plus
3L 28110227 3L 19588679..19588772 2009..2102 470 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19580274..19580922 697..1345 3245 100 Plus
3L 28103327 3L 19581223..19581713 1519..2009 2440 99.7 Plus
3L 28103327 3L 19581929..19582211 2100..2382 1415 100 Plus
3L 28103327 3L 19579635..19579891 216..472 1285 100 Plus
3L 28103327 3L 19579992..19580215 473..696 1120 100 Plus
3L 28103327 3L 19579355..19579570 1..216 1080 100 Plus
3L 28103327 3L 19580981..19581155 1345..1519 860 99.4 Plus
3L 28103327 3L 19581779..19581872 2009..2102 470 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:15:49 has no hits.

FI01412.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:08:22 Download gff for FI01412.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19578212..19578492 2102..2383 99   Plus
chr3L 19578061..19578152 2010..2101 100 -> Plus
chr3L 19577504..19577994 1519..2009 99 -> Plus
chr3L 19577262..19577435 1345..1518 98 -> Plus
chr3L 19576553..19577200 697..1344 100 -> Plus
chr3L 19576271..19576494 473..696 100 -> Plus
chr3L 19575914..19576170 216..472 100 -> Plus
chr3L 19575634..19575848 1..215 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:52:01 Download gff for FI01412.complete
Subject Subject Range Query Range Percent Splice Strand
CG9330-RA 1..2127 128..2254 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:13 Download gff for FI01412.complete
Subject Subject Range Query Range Percent Splice Strand
CG9330-RA 1..2127 128..2254 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:48:28 Download gff for FI01412.complete
Subject Subject Range Query Range Percent Splice Strand
CG9330-RA 1..2127 128..2254 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:08:22 Download gff for FI01412.complete
Subject Subject Range Query Range Percent Splice Strand
CG9330-RA 1..2127 128..2254 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-10 10:40:06 Download gff for FI01412.complete
Subject Subject Range Query Range Percent Splice Strand
CG9330-RA 1..2382 1..2383 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:13 Download gff for FI01412.complete
Subject Subject Range Query Range Percent Splice Strand
CG9330-RA 1..2382 1..2383 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:48:28 Download gff for FI01412.complete
Subject Subject Range Query Range Percent Splice Strand
CG9330-RA 3..2384 1..2382 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:08:22 Download gff for FI01412.complete
Subject Subject Range Query Range Percent Splice Strand
CG9330-RA 3..2384 1..2382 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:08:22 Download gff for FI01412.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19588831..19589111 2102..2383 99   Plus
3L 19588680..19588771 2010..2101 100 -> Plus
3L 19588123..19588613 1519..2009 99 -> Plus
3L 19587881..19588054 1345..1518 99 -> Plus
3L 19587174..19587821 697..1344 100 -> Plus
3L 19586892..19587115 473..696 100 -> Plus
3L 19586535..19586791 216..472 100 -> Plus
3L 19586255..19586469 1..215 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:48:28 Download gff for FI01412.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19581931..19582211 2102..2383 99   Plus
arm_3L 19581780..19581871 2010..2101 100 -> Plus
arm_3L 19581223..19581713 1519..2009 99 -> Plus
arm_3L 19580981..19581154 1345..1518 99 -> Plus
arm_3L 19580274..19580921 697..1344 100 -> Plus
arm_3L 19579992..19580215 473..696 100 -> Plus
arm_3L 19579635..19579891 216..472 100 -> Plus
arm_3L 19579355..19579569 1..215 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:15 Download gff for FI01412.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19581931..19582211 2102..2383 99   Plus
3L 19581780..19581871 2010..2101 100 -> Plus
3L 19581223..19581713 1519..2009 99 -> Plus
3L 19580981..19581154 1345..1518 99 -> Plus
3L 19580274..19580921 697..1344 100 -> Plus
3L 19579992..19580215 473..696 100 -> Plus
3L 19579635..19579891 216..472 100 -> Plus
3L 19579355..19579569 1..215 100 -> Plus

FI01412.pep Sequence

Translation from 127 to 2253

> FI01412.pep
MSEYTSILQREFPKIDHELLTYVVGVLTGSEEDFESGDDIFEAVGDILQS
VDCDRSEESVRTLCEQFLNIMKNNEVNVERKVLNAPVNIEEMAKNMERLD
KDMQSIWVANKDGANKVDSKKLGKAEAKLQQKQEKRQEVNKHGMIPVAVK
LQTATASQVTNKKNTKLDQKGLNRSMDIKIENFDLAFGEKVLLQNANLLL
SYGRRYGLVGRNGLGKTTLLRMIAERQLQIPSHISVLHVEQEVVGDDTPA
VESVLECDTERTRLLTREKEILAALNNGVQDATLSNELSETYASLQNIEA
DKAVARASVILKGLGFDADMQLRPTKSFSGGWRMRLALARALFSKPDLLL
LDEPTNMLDIKAIIWLENYLQTWATTILVVSHDRNFLDTVPTDIIHLHSQ
ELEAYKGNYEQFEKTKTEKLKSQRREYEAQMAHRAHVQDFIDRFRYNANR
ASSVQSKIKMLEKLPELKPVEKETVVTLKFPEVEPLNPPVLAISEVTFRY
NPEDPLPIFKGVNLSATSDSRICIVGENGAGKSTLLKIIVGQLSTIHGNI
VLHRGLRIGYFAQHHVDHLNMNVTCVGVLAELFPGRPDEEYRRQLGSFGI
SGPLALQSIASLSGGQKSRVALAKMCMAEPNFLVLDEPTNHLDIETIDAL
GRAINAFKGGVILVSHDERLIKVVCKELWVCGNRTVRAIEGGLDEYKREV
YKEIEANS*

FI01412.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23707-PA 708 GF23707-PA 1..708 1..708 3630 95.2 Plus
Dana\GF19482-PA 911 GF19482-PA 353..890 169..700 1200 46.2 Plus
Dana\GF22241-PA 617 GF22241-PA 76..605 174..704 1104 42.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16045-PA 708 GG16045-PA 1..708 1..708 3760 99.3 Plus
Dere\GG18434-PA 916 GG18434-PA 347..895 155..700 1211 46 Plus
Dere\GG19381-PA 611 GG19381-PA 70..599 174..704 1095 42.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14627-PA 708 GH14627-PA 1..708 1..708 3528 92.7 Plus
Dgri\GH24766-PA 929 GH24766-PA 371..908 169..700 1198 46 Plus
Dgri\GH17634-PA 614 GH17634-PA 72..605 174..708 1083 41.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG9330-PA 708 CG9330-PA 1..708 1..708 3597 100 Plus
CG1703-PB 901 CG1703-PB 274..880 97..700 1166 42.9 Plus
CG1703-PA 901 CG1703-PA 274..880 97..700 1166 42.9 Plus
CG9281-PD 611 CG9281-PD 5..603 127..708 1055 39.3 Plus
CG9281-PC 611 CG9281-PC 5..603 127..708 1055 39.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13514-PA 708 GI13514-PA 1..708 1..708 3528 92.8 Plus
Dmoj\GI15800-PA 904 GI15800-PA 335..883 155..700 1198 45.4 Plus
Dmoj\GI16072-PA 615 GI16072-PA 73..602 174..704 1109 42.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20943-PA 708 GL20943-PA 1..708 1..708 3589 94.2 Plus
Dper\GL16523-PA 611 GL16523-PA 70..599 174..704 1099 42.5 Plus
Dper\GL12895-PA 436 GL12895-PA 20..435 155..567 878 45.6 Plus
Dper\GL12895-PA 436 GL12895-PA 54..288 508..705 187 26.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21707-PA 708 GA21707-PA 1..708 1..708 3585 94.2 Plus
Dpse\GA14282-PA 924 GA14282-PA 356..903 155..700 1206 46 Plus
Dpse\GA21666-PA 611 GA21666-PA 70..599 174..704 1101 42.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19597-PA 708 GM19597-PA 1..708 1..708 3774 99.7 Plus
Dsec\GM13097-PA 902 GM13097-PA 333..881 155..700 1196 45.8 Plus
Dsec\GM22536-PA 611 GM22536-PA 70..599 174..704 1099 42.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14814-PA 708 GD14814-PA 1..708 1..708 3768 99.6 Plus
Dsim\GD15784-PA 611 GD15784-PA 70..599 174..704 1099 42.5 Plus
Dsim\GD17036-PA 365 GD17036-PA 119..344 472..700 513 45 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11875-PA 708 GJ11875-PA 1..708 1..708 3532 92.8 Plus
Dvir\GJ18654-PA 914 GJ18654-PA 356..893 169..700 1197 45.9 Plus
Dvir\GJ15717-PA 615 GJ15717-PA 73..602 174..704 1106 42.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25825-PA 710 GK25825-PA 3..709 2..707 3522 92.8 Plus
Dwil\GK25023-PA 890 GK25023-PA 321..869 155..700 1203 46 Plus
Dwil\GK10328-PA 611 GK10328-PA 70..599 174..704 1102 42.5 Plus
Dwil\GK19939-PA 1605 GK19939-PA 476..627 523..666 172 32.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19611-PA 708 GE19611-PA 1..708 1..708 3768 99.4 Plus
Dyak\GE23211-PA 711 GE23211-PA 1..711 1..708 3750 98.9 Plus
Dyak\GE15656-PA 907 GE15656-PA 338..886 155..700 1207 46 Plus
Dyak\GE16028-PA 611 GE16028-PA 70..599 174..704 1097 42.4 Plus

FI01412.hyp Sequence

Translation from 127 to 2253

> FI01412.hyp
MSEYTSILQREFPKIDHELLTYVVGVLTGSEEDFESGDDIFEAVGDILQS
VDCDRSEESVRTLCEQFLNIMKNNEVNVERKVLNAPVNIEEMAKNMERLD
KDMQSIWVANKDGANKVDSKKLGKAEAKLQQKQEKRQEVNKHGMIPVAVK
LQTATASQVTNKKNTKLDQKGLNRSMDIKIENFDLAFGEKVLLQNANLLL
SYGRRYGLVGRNGLGKTTLLRMIAERQLQIPSHISVLHVEQEVVGDDTPA
VESVLECDTERTRLLTREKEILAALNNGVQDATLSNELSETYASLQNIEA
DKAVARASVILKGLGFDADMQLRPTKSFSGGWRMRLALARALFSKPDLLL
LDEPTNMLDIKAIIWLENYLQTWATTILVVSHDRNFLDTVPTDIIHLHSQ
ELEAYKGNYEQFEKTKTEKLKSQRREYEAQMAHRAHVQDFIDRFRYNANR
ASSVQSKIKMLEKLPELKPVEKETVVTLKFPEVEPLNPPVLAISEVTFRY
NPEDPLPIFKGVNLSATSDSRICIVGENGAGKSTLLKIIVGQLSTIHGNI
VLHRGLRIGYFAQHHVDHLNMNVTCVGVLAELFPGRPDEEYRRQLGSFGI
SGPLALQSIASLSGGQKSRVALAKMCMAEPNFLVLDEPTNHLDIETIDAL
GRAINAFKGGVILVSHDERLIKVVCKELWVCGNRTVRAIEGGLDEYKREV
YKEIEANS*

FI01412.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG9330-PA 708 CG9330-PA 1..708 1..708 3597 100 Plus
CG1703-PB 901 CG1703-PB 274..880 97..700 1166 42.9 Plus
CG1703-PA 901 CG1703-PA 274..880 97..700 1166 42.9 Plus
CG9281-PD 611 CG9281-PD 5..603 127..708 1055 39.3 Plus
CG9281-PC 611 CG9281-PC 5..603 127..708 1055 39.3 Plus