Clone FI01459 Report

Search the DGRC for FI01459

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:59
Vector:pFlc-1
Associated Gene/TranscriptCG9590-RA
Protein status:FI01459.pep: gold
Sequenced Size:1557

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9590 2008-04-29 Release 5.5 accounting
CG9590 2008-08-15 Release 5.9 accounting
CG9590 2008-12-18 5.12 accounting

Clone Sequence Records

FI01459.complete Sequence

1557 bp assembled on 2007-09-05

GenBank Submission: BT030787

> FI01459.complete
GACTGAGTTGACAGCTCTGACTCAAATCCTAAAAATCTACGTGGAGCAAA
AATAAACAAATAATGGCAAAAAATCCAAAAAAGGAGGAGGACGGCGGTAA
CGACTGGGCCCAAAGTGACGAGGACGACAACTGGGACGATTGGGGCGATG
ACGATGACAAGTTCGTTCACGTGGAGAAGGAACAGCAGCCACAGGAGAAA
GTCTCGAGCAGAAACGACGCAAAAGGAACGGCGGAAAATCAGGAAAAGCT
GGAAACTCCCAGAATTTCTGCTCCAGCAACAGCATCCGCCACATCCTCGT
CCTGGGGTCTGTGGGGCGGTAAACTGAGCTCCGTGCTAACCACCGCCACG
GAGGGATTGGGCACGATAACCACCCAAGTCAACCAGGGGCTTAATCAAAT
CATCGGAGTGCCCGATCCCGAGGAGCTGGCTCGCATTAATGTGGCTGAAA
AGGCGGAAAAGGCTGCTAAAGCGCCGCCAGAGGAAAATGTCGACGATGAA
AAAGAATCTTCGGCCGCCTTTGGCTTGGACTTTGTCACCAATCTGGGCTC
CAAGGTTCTCAACACCGGACTGGATACACTCGAGGGCATTGGCAAGAAGA
CCATGACCATCCTGCAGGACAACGATCCCAAGCTGATGAACAAGAGGAAA
CTGCTCGGTCTGGAGGCCAACTCGCCTAATTTGAGTGCCGTGTTGCTGGA
GGCAAAGAAGGAGGCCGACCAAATGGAGCAATCCCTGCAACAGCTACAGC
TGAAAAGACAGAAGGCGCAGCTGCGTTTCGAAATCCTTTTCGAAAATTAC
TGCGGCCTGGTGCACTTCGAGGCCCTGGAGATCCTTTCCAAGGAGTCACG
CCTCAAACTGGACACCCTACTCGATGCGGTTAGTGGCAATGCCCGTGCAG
AGTTGCAGGAAACGATAAACGAGGTGAAGGAACTGATCGAACTGGAGGAT
CTGGATGTGGAGAGTGAAGGTGACTACGAGGCGGAGGAACTGAGCGAGCG
ATTGGCGGCCACAATCAAGGACGCCGAGCTGGGCATTCAGTTTGACGACA
TAGCCAATCACTGGACGCAGTCCCTCAGCTGGTTGACCTCAGAGGAAGCA
ACTGCCGCCGATCTGGAGCAAGCCTATGCTAAGAGCATCCACGCGCTGAG
TGAAGCGTGCGCCCTCGAGATGTGTAAGCTGCACAAAATCGCCGAGCTGT
TGCTGGTGAAGCCACATCACAGCACCGCCAACGAAGTGGATGGCGTCGTC
AATCTCTGCCAGCAGTTCAATGGACACCTTCAAGGACTTAGCCACCGCTT
CGCCGCCGTTCTGAGCGGCAAGTCAGAAACGGAGGAATCAAAAGGCCGGG
TCAGCACATTCTTTTCCGAAATGCTATCTGCCGTGCAGTTCATCGAGAAG
GCCTACAAGCTATTTACACCCATTCTCCAGATGGGAGCTGTGTAAACGGA
TTTAAGATTAATTGTTGTACTTTCTACTTTTACTATTGCCTGGTTAGTGT
TCTCAACTCACTTGTTTTTCCATATAAATGTACAAAATTATAAAAAAAAA
AAAAAAA

FI01459.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG9590-RA 1735 CG9590-RA 85..1627 2..1544 7715 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11611307..11612362 2..1057 5265 99.9 Plus
chr3R 27901430 chr3R 11612422..11612905 1058..1541 2420 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG9590-RA 1383 CG9590-PA 1..1383 63..1445 6915 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:19 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG9590-RA 1578 CG9590-RA 1..1540 2..1541 7700 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG9590-PA 460 CG9590-PA 1..460 63..1442 1806 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:23:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15786703..15787758 2..1057 5280 100 Plus
3R 32079331 3R 15787818..15788304 1058..1544 2435 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15527534..15528589 2..1057 5280 100 Plus
3R 31820162 3R 15528649..15529135 1058..1544 2435 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:23:16 has no hits.

FI01459.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:34:57 Download gff for FI01459.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11612422..11612905 1058..1541 100   Plus
chr3R 11611305..11612362 1..1057 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:02 Download gff for FI01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG9590-RA 1..1383 63..1445 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:23:06 Download gff for FI01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG9590-RA 1..1383 63..1445 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:28:25 Download gff for FI01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG9590-RA 1..1383 63..1445 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:32 Download gff for FI01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG9590-RA 1..1383 63..1445 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:34:57 Download gff for FI01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG9590-RA 1..1383 63..1445 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:39:24 Download gff for FI01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG9590-RA 1..1542 1..1541 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:23:06 Download gff for FI01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG9590-RA 1..1542 1..1541 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:28:25 Download gff for FI01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG9590-RA 1..1540 2..1541 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:32 Download gff for FI01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG9590-RA 1..1542 1..1541 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:34:57 Download gff for FI01459.complete
Subject Subject Range Query Range Percent Splice Strand
CG9590-RA 1..1540 2..1541 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:34:57 Download gff for FI01459.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15787818..15788301 1058..1541 100   Plus
3R 15786701..15787758 1..1057 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:28:25 Download gff for FI01459.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11613540..11614023 1058..1541 100   Plus
arm_3R 11612423..11613480 1..1057 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:57 Download gff for FI01459.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15528649..15529132 1058..1541 100   Plus
3R 15527532..15528589 1..1057 99 -> Plus

FI01459.pep Sequence

Translation from 62 to 1444

> FI01459.pep
MAKNPKKEEDGGNDWAQSDEDDNWDDWGDDDDKFVHVEKEQQPQEKVSSR
NDAKGTAENQEKLETPRISAPATASATSSSWGLWGGKLSSVLTTATEGLG
TITTQVNQGLNQIIGVPDPEELARINVAEKAEKAAKAPPEENVDDEKESS
AAFGLDFVTNLGSKVLNTGLDTLEGIGKKTMTILQDNDPKLMNKRKLLGL
EANSPNLSAVLLEAKKEADQMEQSLQQLQLKRQKAQLRFEILFENYCGLV
HFEALEILSKESRLKLDTLLDAVSGNARAELQETINEVKELIELEDLDVE
SEGDYEAEELSERLAATIKDAELGIQFDDIANHWTQSLSWLTSEEATAAD
LEQAYAKSIHALSEACALEMCKLHKIAELLLVKPHHSTANEVDGVVNLCQ
QFNGHLQGLSHRFAAVLSGKSETEESKGRVSTFFSEMLSAVQFIEKAYKL
FTPILQMGAV*

FI01459.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 19:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18539-PA 475 GF18539-PA 1..475 1..460 1739 78.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 19:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16949-PA 467 GG16949-PA 1..467 1..460 1952 89.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 19:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18219-PA 485 GH18219-PA 37..485 33..460 1460 68.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG9590-PA 460 CG9590-PA 1..460 1..460 2333 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 19:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10173-PA 473 GI10173-PA 1..473 1..460 1644 69.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 19:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22233-PA 470 GL22233-PA 1..470 1..460 1626 76.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 19:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21897-PA 470 GA21897-PA 1..470 1..460 1594 76.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 19:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24257-PA 278 GM24257-PA 1..278 192..460 1023 78.1 Plus
Dsec\GM24256-PA 180 GM24256-PA 1..179 1..179 699 93.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 19:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19045-PA 460 GD19045-PA 1..460 1..460 2171 95.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 19:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10874-PA 473 GJ10874-PA 1..473 1..460 1587 70.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 19:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11418-PA 477 GK11418-PA 1..477 1..460 1549 71.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 19:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24336-PA 475 GE24336-PA 1..475 1..460 1986 88.8 Plus

FI01459.hyp Sequence

Translation from 62 to 1444

> FI01459.hyp
MAKNPKKEEDGGNDWAQSDEDDNWDDWGDDDDKFVHVEKEQQPQEKVSSR
NDAKGTAENQEKLETPRISAPATASATSSSWGLWGGKLSSVLTTATEGLG
TITTQVNQGLNQIIGVPDPEELARINVAEKAEKAAKAPPEENVDDEKESS
AAFGLDFVTNLGSKVLNTGLDTLEGIGKKTMTILQDNDPKLMNKRKLLGL
EANSPNLSAVLLEAKKEADQMEQSLQQLQLKRQKAQLRFEILFENYCGLV
HFEALEILSKESRLKLDTLLDAVSGNARAELQETINEVKELIELEDLDVE
SEGDYEAEELSERLAATIKDAELGIQFDDIANHWTQSLSWLTSEEATAAD
LEQAYAKSIHALSEACALEMCKLHKIAELLLVKPHHSTANEVDGVVNLCQ
QFNGHLQGLSHRFAAVLSGKSETEESKGRVSTFFSEMLSAVQFIEKAYKL
FTPILQMGAV*

FI01459.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG9590-PA 460 CG9590-PA 1..460 1..460 2333 100 Plus