Clone FI01461 Report

Search the DGRC for FI01461

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:61
Vector:pFlc-1
Associated Gene/TranscriptCG32544-RA
Protein status:FI01461.pep: gold
Sequenced Size:1646

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32544-RA 2009-01-21 est gleaning

Clone Sequence Records

FI01461.complete Sequence

1646 bp assembled on 2009-08-17

GenBank Submission: BT099622.1

> FI01461.complete
GAGTCGTTGGGTGATAGAGTGTTCGGAAGCATGTCGTCGGAGCAGCCGGA
GAACACCAGCTACGAGCAGGAATGCCAACGGGCGGAGCTGCTGGGCCTCC
AGCCACCGGATCCCGCGGAGTTCGAGCGCAAACGGCAGGCACGACTGGAG
CACGAGTTGGCCGAGCAAGAGGCCGCCGAGGCGGTGCTGCTGGAGCAACA
AGACGAGAGTCTGGGCAATGTGGGCGGCAAGCTGGGCGAGCTCAATAGCA
TCCTGTCCAGCACGCAGCAGAAGCTGAATCGCTTCAAGCAAACGGCATGT
GGCAGTTTGACCAACATATTTGCCCGGGCCAGCTCGGGCTCGGTGGATCT
TTCGGCGGGCATTGGTAGATCGGGCTCAATCGCCTCCACACAGGAGGAGC
GTCCTCCTGTCCAGGAACAGCCACTGGCCAAGCCTCCGCCGACGGCTGCC
GAGGTCAGCGCCGCCAAGGCGGCCAAGCAGAAGCGCATGGACTCGCAGCT
GGACAAGCTGGATGCGCTGATCAACCAGGCGGACAACGCTCAGATAGCCA
TGAGTGAGCAGACACAGCAGATGCGCCGCCTGGCCAAGTGAAGTGCCCCC
TTGAGCAGGTGATCATCCATTGCTGACCCGCGAAGCCCACAAAGAAACAG
GCGTTTGCTTCATGAAATGAATGTGTATATGATTCCAACTTTATTTATCC
TCACTCCTCAGGTGATCCTTGTCGCCTGATCCCGGGCAGCCTTCTTCTCC
TCTTCTTTATTTGGATGAACACATGAGTTTCGCTTAAAACTAAACACAAG
TTGAGATTACCCAAAGCGTCTTCAATCACATTTATCGAGTGTGCAGACAG
TGCGAGTCATGCATGACTGTCTGTAGTACCGTCTTACAGTCACGGCGCGC
ACTGCTCCGCCTTACATTCATCCCATTTTGACTTTAAATATATACATATA
AATAGTTGTTTTCCATATACTTTACATCAGAGTTTTGAAATTACAATTTT
TCTCGGCTATTCGTTGACATGCGTAGTTGCGAACAGAATTACAAATGTTG
GACAATAATAGTTGTGTGTAAATGTTTACGCAGCTAAATCATAGTTCATA
CATATTCTGTTTTAATCTTGTTTCTGGAAACATATTGAAGTATATTAGTA
TATATTTATAATATATGTTTTTCGTAAGCAATAACTTTTCTTTTTTCGTT
TAGTCCATTTTTTGTTTTTTTTTTTGTTTTGGTAAGTCACATTTTGGAAA
ACTTGTTAATTCAGTTCTTTGAAAATATATTAAAATTGAATATTTTCAAT
ATTTCAATTTTACTTTTAAACTATTACTCTACTCTCATTTTTTTCTCGTT
AACTTAAGTGAATTAATAGGGAACGTCAAAGTGTAAGCAAAAGCAAACAA
TCTTCTTACTTTTCTTCAAAACATGTGCAGTGCGTTTCGCAGCTGTAAGG
CCAAGACATTGGCACTTACAGTCACGGAACGCACTGCATTTGTGCTAGTA
CATACATATATATAGAAGTCGTTTATCCAGCTAATACTTGTTGCAAAACG
TTTGTTAAACTATATATAATATACATATATATATATAACGATCGAGTCAA
GCAATAAAATCAAAATTTTCTTCACAAAACAAAAAAAAAAAAAAAA

FI01461.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:31:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG32544.a 1217 CG32544.a 31..1217 2..1188 5920 99.9 Plus
CG32544-RA 753 CG32544-RA 31..753 2..724 3600 99.8 Plus
CG7326-RA 2174 CG7326-RA 1747..2174 1636..1209 2125 99.7 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:57:13
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18749662..18751104 186..1630 7115 99.7 Plus
chrX 22417052 chrX 18749429..18749611 2..186 845 98.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG32544-RB 561 CG32544-PB 1..561 31..591 2790 99.8 Plus
CG32544-RA 561 CG32544-PA 1..561 31..591 2790 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:21 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG32544-RA 1630 CG32544-RA 2..1630 2..1630 8130 99.9 Plus
CG32544-RB 1527 CG32544-RB 606..1527 709..1630 4610 100 Plus
CG7326-RB 2580 CG7326-RB 1813..2580 1630..863 3840 100 Minus
CG32544-RB 1527 CG32544-RB 2..614 2..614 3050 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG32544-PB 186 CG32544-PB 1..186 31..588 643 100 Plus
CG32544-PA 186 CG32544-PA 1..186 31..588 643 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18860520..18861970 186..1636 7225 99.9 Plus
X 23542271 X 18860285..18860469 2..186 925 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18868618..18870068 186..1636 7225 99.8 Plus
X 23527363 X 18868383..18868567 2..186 925 100 Plus
Blast to na_te.dros performed on 2014-11-27 11:57:07 has no hits.

FI01461.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:58:57 Download gff for FI01461.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18749663..18751104 187..1630 94   Plus
chrX 18749428..18749611 1..186 97 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:14:34 Download gff for FI01461.complete
Subject Subject Range Query Range Percent Splice Strand
CG32544-RA 1..561 31..591 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:59:36 Download gff for FI01461.complete
Subject Subject Range Query Range Percent Splice Strand
CG32544-RA 1..561 31..591 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:43 Download gff for FI01461.complete
Subject Subject Range Query Range Percent Splice Strand
CG32544-RA 1..561 31..591 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:58:57 Download gff for FI01461.complete
Subject Subject Range Query Range Percent Splice Strand
CG32544-RA 1..561 31..591 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-17 17:10:52 Download gff for FI01461.complete
Subject Subject Range Query Range Percent Splice Strand
CG32544-RA 2..666 2..666 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:59:36 Download gff for FI01461.complete
Subject Subject Range Query Range Percent Splice Strand
CG32544-RA 2..666 2..666 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:43 Download gff for FI01461.complete
Subject Subject Range Query Range Percent Splice Strand
CG32544-RA 2..1630 2..1630 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:58:57 Download gff for FI01461.complete
Subject Subject Range Query Range Percent Splice Strand
CG32544-RA 2..1630 2..1630 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:58:57 Download gff for FI01461.complete
Subject Subject Range Query Range Percent Splice Strand
X 18860521..18861964 187..1630 99   Plus
X 18860284..18860469 1..186 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:43 Download gff for FI01461.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18754554..18755997 187..1630 99   Plus
arm_X 18754317..18754502 1..186 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:51:20 Download gff for FI01461.complete
Subject Subject Range Query Range Percent Splice Strand
X 18868619..18870062 187..1630 99   Plus
X 18868382..18868567 1..186 99 -> Plus

FI01461.pep Sequence

Translation from 0 to 590

> FI01461.pep
ESLGDRVFGSMSSEQPENTSYEQECQRAELLGLQPPDPAEFERKRQARLE
HELAEQEAAEAVLLEQQDESLGNVGGKLGELNSILSSTQQKLNRFKQTAC
GSLTNIFARASSGSVDLSAGIGRSGSIASTQEERPPVQEQPLAKPPPTAA
EVSAAKAAKQKRMDSQLDKLDALINQADNAQIAMSEQTQQMRRLAK*

FI01461.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19057-PA 184 GF19057-PA 2..184 13..196 583 84.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19195-PA 184 GG19195-PA 2..184 13..196 788 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17821-PA 186 GH17821-PA 5..186 18..196 523 65.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG32544-PB 186 CG32544-PB 1..186 11..196 918 100 Plus
CG32544-PA 186 CG32544-PA 1..186 11..196 918 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21735-PA 186 GI21735-PA 3..186 17..196 539 70.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21351-PA 184 GL21351-PA 1..184 11..196 617 75.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23428-PA 184 GA23428-PA 1..184 11..196 630 76.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22926-PA 186 GM22926-PA 1..186 11..196 943 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19116-PA 186 GJ19116-PA 5..186 18..196 432 68.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20150-PA 184 GK20150-PA 3..184 17..196 556 71.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17757-PA 184 GE17757-PA 2..184 13..196 792 97.8 Plus

FI01461.hyp Sequence

Translation from 1 to 590

> FI01461.hyp
QSLGDRVFGSMSSEQPENTSYEQECQRAELLGLQPPDPAEFERKRQARLE
HELAEQEAAEAVLLEQQDESLGNVGGKLGELNSILSSTQQKLNRFKQTAC
GSLTNIFARASSGSVDLSAGIGRSGSIASTQEERPPVQEQPLAKPPPTAA
EVSAAKAAKQKRMDSQLDKLDALINQADNAQIAMSEQTQQMRRLAK*

FI01461.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG32544-PB 186 CG32544-PB 1..186 11..196 918 100 Plus
CG32544-PA 186 CG32544-PA 1..186 11..196 918 100 Plus