Clone FI01464 Report

Search the DGRC for FI01464

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:64
Vector:pFlc-1
Associated Gene/TranscriptCG18003-RB
Protein status:FI01464.pep: gold
Sequenced Size:1351

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18003 2008-12-18 5.12 accounting
CG11919 2008-12-18 5.12 accounting

Clone Sequence Records

FI01464.complete Sequence

1351 bp assembled on 2008-11-07

GenBank Submission: BT050560.1

> FI01464.complete
GTGGGTTCAGTGCGAGTCTGGGAGATGCGTCAAGAGGTGTTGTCAAACAT
TGTATATTTCCATTCTCCTGTTATATAACAGCCATGGCTTTGGTTTGCGT
AGAGGACTTTGAAAAGAAGGCCGTTGGGCAACTGGAGAAGAATGCCCTGG
ACTACTACCGTAGCGGAGCCGGTGAGCAGTTCACCTTGGGACTGAATCGC
GAGGCCTTCCGCCGGCTACGCTTGCGACCTCGTTGTTTGAGAGATGTCTC
CCGCCTGGACATTAGTACCAAGATCTTCGGCGAGCAGATGCAGTGGCCTC
TGGGCATTGCTCCGACGGCTATGCAGAAGATGGCCCATCCGGACGGCGAG
GTAGGCAATGCCAGGGCGGCCGGAAAAGCCGGCTCCATCTTTATACTCAG
CACACTGTCCACCACTTCGCTGGAGGATTTGGCAGCCGGTGCCCCGGATA
CCATCAAATGGTTCCAACTGTACATCTACAAGGATCGTACCATAACGGAA
AAGCTGGTACGTCGTGCCGAGAAGGCGAACTTCAAAGCGCTCGTCCTGAC
CATCGATGCTCCAATCTTTGGACACCGTAGAGCCGATGTGCGCAACAACT
TCAGCTTGCCGTCGCACCTGTCATTGGCCAATTTCCAGGGCGTTAAGGCT
ACTGGAGTGGGTAATGCCGCTATGGGCGCCTCAGGCATTAATGAGTACGT
CTCCAGCCAGTTTGATCCAACCATAACCTGGAAGGATATTGCCTGGTTGA
AGGGCATCACTCATCTGCCCATTGTGGTCAAGGGAGTGCTGACTGCCGAA
GATGCTGTGTTGGCCCAGGAGTTTGGATGCGCCGGACTCATTGTTTCCAA
CCACGGTGCTCGTCAGATCGATACGGTTCCGGCCTCGATCGAAGCCCTGC
CGGAGATCGTAAAGGCCGTGGGAGATAATCTGGTGGTTATGCTGGACGGA
GGCATTATGCAGGGCAATGATATCTTCAAGGCTTTGGCTTTGGGAGCCAA
GACGGTCTTTGTGGGTCGTCCGGCTGTCTGGGGATTGGCCTACAATGGAC
AGAAAGGCGTGGAGGAGATGCTGAGTGTGCTGAGAAAGGACTTTGAGACC
ACCATGGCGCTGATCGGTTGCCAAAATTTGGGAGACATCACGTCGGCAAT
GGTGGTACATGAGAGTCAATATGCCAAGCTGTAAATCAGGAACGTTTTAG
TGTAGATACATAAAACTTATCAAACTTGCTTTCATAAATCCAATAAACAT
GTCAATAAATAAATATATAATAAATAGATAGATAGATAGATAAATAAACA
GATTCCAGCAATTAAAACCTAAAAAAAAAAAAAAGAAAAAAAAAAAAAAA
A

FI01464.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG18003-RA 4666 CG18003-RA 3347..4666 1..1320 6585 99.9 Plus
CG11919-RA 4666 CG11919-RA 3347..4666 1..1320 6585 99.9 Plus
CG18003-RB 1320 CG18003-RB 1..1320 1..1320 6585 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6771694..6772528 487..1321 4160 99.9 Plus
chr2R 21145070 chr2R 6771140..6771626 1..487 2420 99.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG18003-RB 1101 CG18003-PB 1..1101 84..1184 5505 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:24 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG18003-RB 1322 CG18003-RB 3..1322 1..1320 6585 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG18003-PB 366 CG18003-PB 1..366 84..1181 1712 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10884103..10884937 487..1321 4175 100 Plus
2R 25286936 2R 10883549..10884035 1..487 2420 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10885302..10886136 487..1321 4175 100 Plus
2R 25260384 2R 10884748..10885234 1..487 2420 99.7 Plus
Blast to na_te.dros performed on 2014-11-27 03:57:10 has no hits.

FI01464.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:22:16 Download gff for FI01464.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6771695..6772527 488..1320 93   Plus
chr2R 6771140..6771626 1..487 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:06 Download gff for FI01464.complete
Subject Subject Range Query Range Percent Splice Strand
CG18003-RA 20..1203 1..1184 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:19:32 Download gff for FI01464.complete
Subject Subject Range Query Range Percent Splice Strand
CG18003-RC 20..1203 1..1184 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:23:11 Download gff for FI01464.complete
Subject Subject Range Query Range Percent Splice Strand
CG18003-RB 1..1101 84..1184 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:22:16 Download gff for FI01464.complete
Subject Subject Range Query Range Percent Splice Strand
CG18003-RB 1..1101 84..1184 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 08:00:36 Download gff for FI01464.complete
Subject Subject Range Query Range Percent Splice Strand
CG18003-RB 1..1320 1..1320 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:19:32 Download gff for FI01464.complete
Subject Subject Range Query Range Percent Splice Strand
CG18003-RB 1..1320 1..1320 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:11 Download gff for FI01464.complete
Subject Subject Range Query Range Percent Splice Strand
CG18003-RB 3..1322 1..1320 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-07 10:24:44 Download gff for FI01464.complete
Subject Subject Range Query Range Percent Splice Strand
CG18003-RB 1..1320 1..1320 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:22:16 Download gff for FI01464.complete
Subject Subject Range Query Range Percent Splice Strand
CG18003-RB 3..1322 1..1320 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:22:16 Download gff for FI01464.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10884104..10884936 488..1320 100   Plus
2R 10883549..10884035 1..487 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:11 Download gff for FI01464.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6771609..6772441 488..1320 100   Plus
arm_2R 6771054..6771540 1..487 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:50:54 Download gff for FI01464.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10885303..10886135 488..1320 100   Plus
2R 10884748..10885234 1..487 99 -> Plus

FI01464.pep Sequence

Translation from 2 to 1183

> FI01464.pep
GFSASLGDASRGVVKHCIFPFSCYITAMALVCVEDFEKKAVGQLEKNALD
YYRSGAGEQFTLGLNREAFRRLRLRPRCLRDVSRLDISTKIFGEQMQWPL
GIAPTAMQKMAHPDGEVGNARAAGKAGSIFILSTLSTTSLEDLAAGAPDT
IKWFQLYIYKDRTITEKLVRRAEKANFKALVLTIDAPIFGHRRADVRNNF
SLPSHLSLANFQGVKATGVGNAAMGASGINEYVSSQFDPTITWKDIAWLK
GITHLPIVVKGVLTAEDAVLAQEFGCAGLIVSNHGARQIDTVPASIEALP
EIVKAVGDNLVVMLDGGIMQGNDIFKALALGAKTVFVGRPAVWGLAYNGQ
KGVEEMLSVLRKDFETTMALIGCQNLGDITSAMVVHESQYAKL*

FI01464.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:20:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13782-PA 366 GF13782-PA 1..366 28..393 1732 92.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20155-PA 366 GG20155-PA 1..366 28..393 1801 96.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20058-PA 364 GH20058-PA 1..364 28..393 1574 83.6 Plus
Dgri\GH21788-PA 366 GH21788-PA 1..362 28..390 1377 71.9 Plus
Dgri\GH21787-PA 366 GH21787-PA 1..362 28..390 1370 71.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG18003-PB 366 CG18003-PB 1..366 28..393 1865 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18775-PA 364 GI18775-PA 1..364 28..393 1583 83.3 Plus
Dmoj\GI18893-PA 365 GI18893-PA 1..364 28..393 1322 68.6 Plus
Dmoj\GI19331-PA 366 GI19331-PA 1..362 28..390 1280 68 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20092-PA 366 GL20092-PA 1..366 28..393 1725 91.5 Plus
Dper\GL10464-PA 282 GL10464-PA 23..236 82..337 811 65.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15579-PA 366 GA15579-PA 1..366 28..393 1725 91.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21244-PA 366 GM21244-PA 1..366 28..393 1835 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10762-PA 366 GD10762-PA 1..366 28..393 1913 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21802-PA 364 GJ21802-PA 1..364 28..393 1594 82.8 Plus
Dvir\GJ21929-PA 366 GJ21929-PA 1..365 28..393 1362 72.7 Plus
Dvir\GJ22209-PA 365 GJ22209-PA 1..365 28..393 1358 70.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20637-PA 365 GK20637-PA 1..365 28..393 1731 86.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12845-PA 366 GE12845-PA 1..366 28..393 1814 97 Plus

FI01464.hyp Sequence

Translation from 2 to 1183

> FI01464.hyp
GFSASLGGASRGVVKHCIFPFSCYITAMALVCVEDFEKKAVGQLEKNALD
YYRSGAGEQFTLGLNREAFRRLRLRPRCLRDVSRLDISTKIFGEQMQWPL
GIAPTAMQKMAHPDGEVGNARAAGKAGSIFILSTLSTTSLEDLAAGAPDT
IKWFQLYIYKDRTITEKLVRRAEKANFKALVLTIDAPIFGHRRADVRNNF
SLPSHLSLANFQGVKATGVGNAAMGASGINEYVSSQFDPTITWKDIAWLK
GITHLPIVVKGVLTAEDAVLAQEFGCAGLIVSNHGARQIDTVPASIEALP
EIVKAVGDNLVVMLDGGIMQGNDIFKALALGAKTVFVGRPAVWGLAYNGQ
KGVEEMLSVLRKDFETTMALIGCQNLGDITSAMVVHESQYAKL*

FI01464.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG18003-PB 366 CG18003-PB 1..366 28..393 1865 100 Plus