Clone FI01467 Report

Search the DGRC for FI01467

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:67
Vector:pFlc-1
Associated Gene/Transcriptvari-RD
Protein status:FI01467.pep: gold
Sequenced Size:2731

Clone Sequence Records

FI01467.complete Sequence

2731 bp assembled on 2009-01-05

GenBank Submission: BT056231.1

> FI01467.complete
GAGTTAGCCTCTTTCTCACAAACAAGTCGGTTGTTTTTGCGCTGTTGGAG
GAGTGAAATTCTTAGCCGCGCTATTGTTTTTGTTGTTTGCGTGGCGTTGT
GTTTATAACAATAACAACAAGTGATTATCACTGGAAGACATGTTCTGTTC
AAGTAGCTAAGCATATGGCTGGCTAAGAAAAAAAACACAAGGGTTATAAC
CCTTTTTTGGCCGAAATACGAGACTGTCCTCCGGGGTTACTTCATTCGGT
CTGTTATTTTGGCCACCTCCCAGTTCCTTCAAAATGGTTCGGTGGAGCGC
GCGGTCGCGGCGCCAAGCTCGCCAGGATAAAGTGGAGCTATTGGCCAGAA
ACAACAAAGTGAATGGCGAGGACGATACCTCCGATAACGCCGCCTTTCGC
AACTCGACTGACCTATCCGACCACGATGAGATCTTCCTCAAGGGATTGCT
GCGTAGTAACTCCAACACGCCCCACAAGGAACTGATGCTGAATCCGACCG
AGCCGCAGCCAGTGCCACTATTCCTGCCCGCTCATCTGAACAACAAGCCC
ATCTGCGACGACATCATCCGCAAGTTCTCACCCTCGAGGCGCCTGGAGTC
GCGAGAACTCGCCAAGCTTCTCGCCCAGCCGCATTTTCGTGCTCTTTTGC
GCGCCCATGATGAGATAGGAGCACTCTACGAGCAACGACTTAAAGCTGCC
GGGGGATCCACCAGCCAACTAGAGATCGCCAGCCAACGCCAAACGGGAGG
CTACCTGTTCACCGAGGACGTCCTCAACACCAAGATGCCAGTGGAGACCA
TCAAGATGGTGGGTCTGCGCCGAGATCCCAGCAAGCCGCTGGGCCTGACC
GTCGAACTGGACGAATTCAAGCAGCTGGTCGTGGCCAGGATTCTGGCGGG
CGGGGTGATCGACAAACAGAGCATGCTGCACGTTGGCGATGTCATCCTAG
AGGTGAACGGTACGCCCGTTCGCACTCCCGATGAGCTGCAGGTGGAGGTG
TCGCGGGCCAAGGAGAATCTCACCCTCAAGATCGGGCCGAACGTGGACGA
GGAGATCAAGAGCGGTCGCTATACTTGCTACATGCGTGCCCTTTTCACAT
ACAATCCATCCGAAGATTCCTTGCTGCCATGCAGGGATATTGGATTGCCC
TTCAAGTCGGGCGACATTTTGCAGATCATCAACGTAAAGGATCCCAACTG
GTGGCAGGCCAAGAACATTACTGCCGAATCTGACAAAATTGGACTCATAC
CATCCCAAGAGCTGGAGGAGCGGCGCAAAGCCTTCGTGGCCCCCGAGGCG
GACTACGTTCACAAGATTGGCATTTGCGGAACAAGAATCTCGAAGCGAAA
GCGCAAGACCATGTACCGATCTGTGGCCAATTGCGAGTTCGACAAGGCGG
AGCTGCTGCTCTATGAGGAGGTCACGCGGATGCCGCCGTTCCGCAGGAAA
ACCCTGGTTCTCATCGGTGTTTCCGGTGTGGGAAGACGTACGCTCAAGAA
TCGGCTGATCAACAGCGATGTGGACAAGTTCGGAGCGGTCATTCCACATA
CCAGTCGCCCCAAGCGCGCCTTGGAGGAGAACGGCAGTAGCTACTGGTTC
ATGGACCGCGAGGAAATGGAAGAGGCCGTGCGGAACAACGAGTTCCTGGA
GTACGGCGAGCACAATGGCAATCTGTACGGCACGCATTTGCAGTCCATCA
AGGATGTGATCAACAGTGGGCGCATGTGCATCCTGGATTGTGCACCGAAT
GCCCTGAAGATCCTGCACAACAGCCAGGAACTGATGCCTTTTGTCATCTT
TGTGGCAGCGCCTGGCATGGAGCAGCTCAAGACCATCTATGCGGATCGCA
GGGCCACGGGCTCCAACCGGAATTTATCTTTTGATCGCCAGAGTTCCATA
AGATTCAGCTCCAGACGCGCCCGTACGCTCGAGTCCCTAGCGTCGTTGTA
TGAGGACGACGACCTTGTCGCCACCGTCGAGGAGAGCAGCTTCGTCCAGC
GCAAGTATGAGAAATACTTCGACATGGTCATCGTGAACGAGGACTTCGAT
GAGACGTTCCGCCAGGTGGTGGAAACGCTGGATCAGATGAGCCACGAGGA
GCAGTGGGTGCCTGTCAACTGGATCTACTAGAATCCCATGACCCTTTGCA
ATTGCGCCTTTATGCATATTGAAGAATATATACTATAAAAATCGAATGCC
TATCATCACAATTAAAGGGATAATTCCAGTAATTGAAGCTTAAACTCGCA
ACACAATACAAATTTAGCGAAGAGCATTTAAAACGCTAGCGATTTCAATA
TTTATTGTTGATTAGACGTGTTTTGCTTGAGGAATGTAATGCGTTTTATT
AACTATGTTTATCTCAATTACTGTCATTTTCCTCTTTAAATATAAATCAT
GTATATATGCAATGTTTGTATAAGTTGAAATGCGCCCTCCGTTTACAATT
CAGTTTTCCTTAAGTATAAGCCTAATTTTACGAAACGAATTCGTCCATTT
TACCATCTCTTGTTTTATTTTTACAAATAATGAATGATGTCAACGCATAT
CTCTTCAGTTTATTATTTTAACGAATCTCCTCAGTACAACAACCTTCTGC
CAATATTTTCGTGTAGTTTTTAGATTTGTTTGAATAAAATGTGTAAGTTT
AACGAACTAGTTAAATGTATTGATGTGGAGTTAAACAAACGAAATACGAA
TAAATTTGGCTCAAAGAAAAAAAAAAAAAAA

FI01467.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
vari-RD 2735 vari-RD 1..2718 2..2719 13560 99.9 Plus
vari.c 2643 vari.c 1..1878 2..1879 9360 99.8 Plus
vari-RB 2800 vari-RB 1140..2783 1076..2719 8205 99.9 Plus
vari-RB 2800 vari-RB 3..1076 2..1075 5355 99.9 Plus
vari.c 2643 vari.c 1879..2643 1955..2719 3825 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20787167..20787930 2716..1953 3775 99.6 Minus
chr2L 23010047 chr2L 20789735..20790169 1075..641 2130 99.3 Minus
chr2L 23010047 chr2L 20795149..20795536 389..2 1925 99.7 Minus
chr2L 23010047 chr2L 20788226..20788557 1879..1548 1645 99.7 Minus
chr2L 23010047 chr2L 20788630..20788840 1547..1337 1040 99.5 Minus
chr2L 23010047 chr2L 20788896..20789063 1336..1169 840 100 Minus
chr2L 23010047 chr2L 20790618..20790772 641..487 760 99.4 Minus
chr2L 23010047 chr2L 20789127..20789225 1174..1076 495 100 Minus
chr2L 23010047 chr2L 20794532..20794630 487..389 495 100 Minus
chr2L 23010047 chr2L 20788090..20788165 1955..1880 380 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
vari-RD 1848 CG9326-PD 1..1848 284..2131 9210 99.9 Plus
vari-RF 1410 CG9326-PF 355..1410 1076..2131 5265 99.9 Plus
vari-RC 1410 CG9326-PC 355..1410 1076..2131 5265 99.9 Plus
vari-RF 1410 CG9326-PF 1..291 785..1075 1455 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:26 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
vari-RD 2717 CG9326-RD 3..2717 2..2716 13545 99.9 Plus
vari-RF 2379 CG9326-RF 739..2379 1076..2716 8190 99.9 Plus
vari-RC 2320 CG9326-RC 680..2320 1076..2716 8190 99.9 Plus
vari-RF 2379 CG9326-RF 88..675 488..1075 2925 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
vari-PD 615 CG9326-PD 1..615 284..2128 3117 100 Plus
vari-PB 636 CG9326-PB 1..636 284..2128 3085 96.7 Plus
vari-PE 611 CG9326-PE 1..611 284..2128 2931 92.8 Plus
vari-PF 469 CG9326-PF 1..469 785..2128 2284 95.5 Plus
vari-PC 469 CG9326-PC 1..469 785..2128 2284 95.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20788659..20789425 2719..1953 3835 100 Minus
2L 23513712 2L 20791230..20791664 1075..641 2175 100 Minus
2L 23513712 2L 20796653..20797040 389..2 1940 100 Minus
2L 23513712 2L 20789721..20790052 1879..1548 1660 100 Minus
2L 23513712 2L 20790125..20790335 1547..1337 1040 99.5 Minus
2L 23513712 2L 20790391..20790558 1336..1169 840 100 Minus
2L 23513712 2L 20792113..20792267 641..487 760 99.4 Minus
2L 23513712 2L 20790622..20790720 1174..1076 495 100 Minus
2L 23513712 2L 20796037..20796135 487..389 495 100 Minus
2L 23513712 2L 20789585..20789660 1955..1880 380 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20788659..20789425 2719..1953 3835 100 Minus
2L 23513712 2L 20791230..20791664 1075..641 2175 100 Minus
2L 23513712 2L 20796653..20797040 389..2 1940 100 Minus
2L 23513712 2L 20789721..20790052 1879..1548 1660 100 Minus
2L 23513712 2L 20790125..20790335 1547..1337 1040 99.5 Minus
2L 23513712 2L 20790391..20790558 1336..1169 840 100 Minus
2L 23513712 2L 20792113..20792267 641..487 760 99.3 Minus
2L 23513712 2L 20796037..20796135 487..389 495 100 Minus
2L 23513712 2L 20790622..20790720 1174..1076 495 100 Minus
2L 23513712 2L 20789585..20789660 1955..1880 380 100 Minus
Blast to na_te.dros performed on 2014-11-27 10:53:05 has no hits.

FI01467.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:51:56 Download gff for FI01467.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20795149..20795536 1..389 99   Minus
chr2L 20794532..20794629 390..487 100 <- Minus
chr2L 20790619..20790771 488..640 99 <- Minus
chr2L 20789735..20790169 641..1075 99 <- Minus
chr2L 20789127..20789225 1076..1174 100 <- Minus
chr2L 20788896..20789057 1175..1336 100 <- Minus
chr2L 20788630..20788840 1337..1547 99 <- Minus
chr2L 20788226..20788557 1548..1879 99 <- Minus
chr2L 20788091..20788165 1880..1954 100 <- Minus
chr2L 20787167..20787928 1955..2716 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:50:07 Download gff for FI01467.complete
Subject Subject Range Query Range Percent Splice Strand
vari-RD 1..1848 284..2131 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:22:16 Download gff for FI01467.complete
Subject Subject Range Query Range Percent Splice Strand
vari-RD 1..1848 284..2131 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:23:26 Download gff for FI01467.complete
Subject Subject Range Query Range Percent Splice Strand
vari-RD 1..1848 284..2131 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:51:56 Download gff for FI01467.complete
Subject Subject Range Query Range Percent Splice Strand
vari-RD 1..1848 284..2131 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-05 17:18:42 Download gff for FI01467.complete
Subject Subject Range Query Range Percent Splice Strand
vari-RD 1..2715 2..2716 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:22:15 Download gff for FI01467.complete
Subject Subject Range Query Range Percent Splice Strand
vari-RD 1..2715 2..2716 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:23:26 Download gff for FI01467.complete
Subject Subject Range Query Range Percent Splice Strand
vari-RD 2..2717 1..2716 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:51:56 Download gff for FI01467.complete
Subject Subject Range Query Range Percent Splice Strand
vari-RD 2..2717 1..2716 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:51:56 Download gff for FI01467.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20796653..20797040 1..389 99   Minus
2L 20796037..20796134 390..487 100 <- Minus
2L 20792114..20792266 488..640 99 <- Minus
2L 20791230..20791664 641..1075 100 <- Minus
2L 20790622..20790720 1076..1174 100 <- Minus
2L 20790391..20790552 1175..1336 100 <- Minus
2L 20790125..20790335 1337..1547 99 <- Minus
2L 20789721..20790052 1548..1879 100 <- Minus
2L 20789586..20789660 1880..1954 100 <- Minus
2L 20788662..20789423 1955..2716 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:23:26 Download gff for FI01467.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20796653..20797040 1..389 99   Minus
arm_2L 20796037..20796134 390..487 100 <- Minus
arm_2L 20792114..20792266 488..640 99 <- Minus
arm_2L 20791230..20791664 641..1075 100 <- Minus
arm_2L 20790622..20790720 1076..1174 100 <- Minus
arm_2L 20790391..20790552 1175..1336 100 <- Minus
arm_2L 20790125..20790335 1337..1547 99 <- Minus
arm_2L 20789721..20790052 1548..1879 100 <- Minus
arm_2L 20789586..20789660 1880..1954 100 <- Minus
arm_2L 20788662..20789423 1955..2716 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:10:10 Download gff for FI01467.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20796653..20797040 1..389 99   Minus
2L 20796037..20796134 390..487 100 <- Minus
2L 20792114..20792266 488..640 99 <- Minus
2L 20791230..20791664 641..1075 100 <- Minus
2L 20790622..20790720 1076..1174 100 <- Minus
2L 20790391..20790552 1175..1336 100 <- Minus
2L 20790125..20790335 1337..1547 99 <- Minus
2L 20789721..20790052 1548..1879 100 <- Minus
2L 20789586..20789660 1880..1954 100 <- Minus
2L 20788662..20789423 1955..2716 100 <- Minus

FI01467.pep Sequence

Translation from 283 to 2130

> FI01467.pep
MVRWSARSRRQARQDKVELLARNNKVNGEDDTSDNAAFRNSTDLSDHDEI
FLKGLLRSNSNTPHKELMLNPTEPQPVPLFLPAHLNNKPICDDIIRKFSP
SRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLKAAGGSTSQLEIAS
QRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQLVV
ARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKI
GPNVDEEIKSGRYTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIIN
VKDPNWWQAKNITAESDKIGLIPSQELEERRKAFVAPEADYVHKIGICGT
RISKRKRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVG
RRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVR
NNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQEL
MPFVIFVAAPGMEQLKTIYADRRATGSNRNLSFDRQSSIRFSSRRARTLE
SLASLYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLD
QMSHEEQWVPVNWIY*

FI01467.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14547-PA 636 GF14547-PA 1..636 1..615 3184 93.2 Plus
Dana\GF16967-PA 1169 GF16967-PA 751..1169 170..615 738 36.1 Plus
Dana\GF12435-PA 556 GF12435-PA 23..555 38..614 638 30.3 Plus
Dana\GF20363-PA 907 GF20363-PA 428..901 171..615 554 28.3 Plus
Dana\GF19077-PA 1005 GF19077-PA 786..1000 360..610 261 28.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21549-PA 636 GG21549-PA 1..636 1..615 3235 95.6 Plus
Dere\GG22696-PA 595 GG22696-PA 21..594 36..614 638 29.5 Plus
Dere\GG22470-PA 315 GG22470-PA 3..315 266..615 605 37.9 Plus
Dere\GG19306-PA 1299 GG19306-PA 952..1293 266..615 521 30.7 Plus
Dere\GG18414-PA 1004 GG18414-PA 800..999 374..610 261 29.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10158-PA 636 GH10158-PA 1..636 1..615 3057 89.7 Plus
Dgri\GH18714-PA 596 GH18714-PA 178..596 170..615 732 36.1 Plus
Dgri\GH24103-PA 997 GH24103-PA 530..991 171..615 587 29.4 Plus
Dgri\GH12185-PA 828 GH12185-PA 349..823 160..610 375 25.8 Plus
Dgri\GH21953-PA 242 GH21953-PA 9..241 363..614 372 33.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
vari-PD 615 CG9326-PD 1..615 1..615 3173 100 Plus
vari-PB 636 CG9326-PB 1..636 1..615 3141 96.7 Plus
vari-PE 611 CG9326-PE 1..611 1..615 2987 92.8 Plus
vari-PF 469 CG9326-PF 1..469 168..615 2284 95.5 Plus
vari-PC 469 CG9326-PC 1..469 168..615 2284 95.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22442-PA 634 GI22442-PA 13..634 14..615 2987 89.1 Plus
Dmoj\GI22862-PA 594 GI22862-PA 176..594 170..615 746 36.3 Plus
Dmoj\GI19661-PA 556 GI19661-PA 23..555 38..614 617 29.9 Plus
Dmoj\GI14373-PA 897 GI14373-PA 438..891 171..615 586 30.1 Plus
Dmoj\GI16558-PA 223 GI16558-PA 28..154 389..516 260 39.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19590-PA 637 GL19590-PA 1..637 1..615 3124 91.5 Plus
Dper\GL23741-PA 487 GL23741-PA 69..487 170..615 742 36.1 Plus
Dper\GL20641-PA 596 GL20641-PA 23..595 38..614 645 29.7 Plus
Dper\GL20368-PA 918 GL20368-PA 451..912 171..615 564 29.4 Plus
Dper\GL20800-PA 221 GL20800-PA 24..150 389..516 244 38.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:34:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21703-PA 637 GA21703-PA 1..637 1..615 3125 91.5 Plus
Dpse\GA19796-PA 1027 GA19796-PA 619..1027 170..615 747 36.8 Plus
Dpse\GA15582-PB 586 GA15582-PB 23..585 38..614 666 30.2 Plus
Dpse\GA15582-PA 596 GA15582-PA 23..595 38..614 645 29.7 Plus
Dpse\GA17100-PA 1002 GA17100-PA 536..996 171..615 584 29.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23306-PA 636 GM23306-PA 1..636 1..615 3262 96.2 Plus
Dsec\GM23693-PA 591 GM23693-PA 173..591 170..615 743 36.3 Plus
Dsec\GM20471-PA 593 GM20471-PA 19..592 36..614 640 29.5 Plus
Dsec\GM11239-PA 1309 GM11239-PA 962..1303 266..615 521 30.7 Plus
Dsec\GM25224-PA 234 GM25224-PA 37..163 389..516 238 38.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21680-PA 644 GD21680-PA 1..644 1..615 3245 95.2 Plus
Dsim\GD18503-PA 769 GD18503-PA 351..769 170..615 742 36.3 Plus
Dsim\GD25940-PA 377 GD25940-PA 1..376 204..614 593 33.3 Plus
Dsim\GD14257-PA 250 GD14257-PA 42..179 389..516 221 36 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20335-PA 634 GJ20335-PA 13..634 14..615 3036 91 Plus
Dvir\GJ14160-PA 1039 GJ14160-PA 621..1039 170..615 743 36.1 Plus
Dvir\GJ15026-PA 595 GJ15026-PA 137..594 171..614 621 31.8 Plus
Dvir\GJ19412-PA 1381 GJ19412-PA 921..1375 171..615 587 29.7 Plus
Dvir\GJ12810-PA 223 GJ12810-PA 28..154 389..516 257 39.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24864-PA 641 GK24864-PA 13..641 14..615 3017 89.5 Plus
Dwil\GK13019-PA 608 GK13019-PA 190..608 170..615 739 36.1 Plus
Dwil\GK20656-PA 599 GK20656-PA 23..598 38..614 633 29.5 Plus
Dwil\GK25185-PA 1626 GK25185-PA 1159..1620 171..615 582 29.8 Plus
Dwil\GK16229-PA 996 GK16229-PA 792..991 374..610 260 29.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13543-PA 636 GE13543-PA 1..636 1..615 3245 95.8 Plus
Dyak\GE24086-PA 594 GE24086-PA 176..594 170..615 743 36.3 Plus
Dyak\GE13049-PA 315 GE13049-PA 3..314 267..614 525 34.4 Plus
Dyak\GE15771-PA 1719 GE15771-PA 1372..1713 266..615 520 31.1 Plus
Dyak\GE21760-PA 236 GE21760-PA 39..165 389..516 260 41.4 Plus

FI01467.hyp Sequence

Translation from 283 to 2130

> FI01467.hyp
MVRWSARSRRQARQDKVELLARNNKVNGEDDTSDNAAFRNSTDLSDHDEI
FLKGLLRSNSNTPHKELMLNPTEPQPVPLFLPAHLNNKPICDDIIRKFSP
SRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLKAAGGSTSQLEIAS
QRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQLVV
ARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKI
GPNVDEEIKSGRYTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIIN
VKDPNWWQAKNITAESDKIGLIPSQELEERRKAFVAPEADYVHKIGICGT
RISKRKRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVG
RRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVR
NNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQEL
MPFVIFVAAPGMEQLKTIYADRRATGSNRNLSFDRQSSIRFSSRRARTLE
SLASLYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLD
QMSHEEQWVPVNWIY*

FI01467.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
vari-PD 615 CG9326-PD 1..615 1..615 3173 100 Plus
vari-PB 636 CG9326-PB 1..636 1..615 3141 96.7 Plus
vari-PE 611 CG9326-PE 1..611 1..615 2987 92.8 Plus
vari-PF 469 CG9326-PF 1..469 168..615 2284 95.5 Plus
vari-PC 469 CG9326-PC 1..469 168..615 2284 95.5 Plus