Clone FI01812 Report

Search the DGRC for FI01812

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:18
Well:12
Vector:pFlc-1
Associated Gene/TranscriptCG9993-RA
Protein status:FI01812.pep: gold
Sequenced Size:1812

Clone Sequence Records

FI01812.complete Sequence

1812 bp assembled on 2009-07-08

GenBank Submission: BT088911.1

> FI01812.complete
AGTTTATGTGTACGAAAGTTGTGTTTTGTCCAATCGAACGGCCAAAAGGA
ATCCAGAACGCAGAGAGAGCCAAATGGCGTCCACCAAGTACGACAGCTTT
GAGAAGATATGGTCTGGGCCAAAGGACAAGGAGTACTACGGTCCGGATAT
GACGCTGGGCGAGGTGGCACTGATCATCCTGCGTCTGTACTCGGACAAGG
TGATGCAGGTGTATGATCCCACGGGCGAGGAGCTCACCGGTAGTCAGTTG
CTGGAGCAAAGTCGTCGATTGGCCCACGCCTTTCAACGATTGAAGCTGCA
ACGCGGCGATGTGGTTGGCATTTCGGCCAAGAACACCACCTATCTCACCG
AAGTGGTCATCGCAGCCCTGCTGAATGGCACACCCATCAACCCACTGCAT
CCGGACTTCGATGCGGAAACCACGGCCTATATGTTCGAGATCACGAAGCC
CAAGGTGATATTCTGCGACCTGGACAACTACCAGACCTTGAGCGCGGTCA
AAAGCAGTCTCAAGTTCAAGACGGAGATCATTCTGCTCACTGGAACTCTG
CCTGGAGTGCGTAACATTCAGGATTTGCTTGCAGATGGCTGCACTGGATA
CGATGAGAAAACACTCTTTGCCTGCCCGCATTTGTGTGGCGATGATACGG
CCTTCATCATCACCTCCTCGGGTGTAACCGGTTTGCCAAAGGGCGTAACC
CGTTCGCATCGCAGTCTGCTGAACAGTGCCAAAATCCCTCAGCTCTTTAC
CTCGGATACAGTGCTGTTCTGCTTCAGTCCGCTCTATTGGATCAGCTGTA
TCTTCACACTGCTCGCTTCGCTGGTCAATGGATGTCGCAGGATCATCACC
AATCGTCCTTTCAGCGTGGCGTACTTTGCAGACCTTGTGGAACGACACCA
GGTCAGCTTTGTGCTCACAGTGCCCCACCACATGGCTCTGCTGGCCAAGA
GCCCAGAGAGACAGGAGCTAGCAGCCAAGATGCAGTGTGTTCAGTCCTTC
GTGTGCAGTGGCTCGAAGGTACCGATGGGGATCTGGCGGCAGTTGTACGA
GCTACTGGGTGCGAACAGATTCGCCGTGCTCTACGGTCTCACAGAGACCG
GAGGAATCTCCAAGAATGTGGGAGGTCCACTGGGCAGCGAGGGCAGGTTG
CTGCGAAATGTCCAGGTTCGCGTGGTAGACCCACACGGTCAGTCCTTGGG
CCCCAACCAGACGGGCCAGATCCTGGTGCGGCTCAACCTTCGCTGGGGCG
GCTACTATCACAATCCGCAGGAGACCCAGGTGACCGTCACGCCCGACGGC
AAGTGGTTGCTCACCGGCGATCATGGATACTTTGACGATGAGGGCTGCCT
GCACTTTCAGTCCCGTGACACCGATGTCTTCAAGTACAATCACTTCCCCA
TTTATCCCAAGCAGATCGAGGACGTGATTCTCCATCTGCCCGGAGTCCAC
GAAGTGGCTGTCTTCGGAATTCCCGATGAGGTGTCCACCAATCTTACAGC
CTGTGCAGTGGTTCGGAATGAGGATGAGTTGGGTGCCCAGCTGACCGAGG
CGGATGTCAAGGGAGTTGTGGCACAACATCTAAGCGATGCCTTCCACATC
CGCGGAGGAGTCTTCTTTGTGGACAATCTGCCGAAGACGCAGAACAGTAA
GGTGCAGCGCAGGAAGATCTGGTCGCAGTTGAGCGAGGCAACCACACATT
TGTGAGATAAGATTTATGCTAAATATACAATACATGAGTTGTTTATAATC
GTGTTTAATAAATGTAAACACAGTGAATCATCACAAGAACTGTGAAAGAA
AAAAAAAAAAAA

FI01812.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG9993-RA 1881 CG9993-RA 37..1844 1..1808 8980 99.7 Plus
CG9993.a 2089 CG9993.a 245..2052 1..1808 8980 99.7 Plus
CG17999-RA 1858 CG17999-RA 1401..1530 1293..1422 230 78.4 Plus
CG17999-RA 1858 CG17999-RA 413..513 305..405 145 76.2 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16736732..16737794 1798..736 5300 99.9 Minus
chr2R 21145070 chr2R 16738292..16738707 416..1 2065 99.8 Minus
chr2R 21145070 chr2R 16738035..16738234 615..416 1000 100 Minus
chr2R 21145070 chr2R 16737853..16737972 735..616 600 100 Minus
chr2R 21145070 chr2R 16734779..16734998 1512..1293 290 75.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG9993-RA 1632 CG9993-PA 1..1632 74..1705 8145 99.9 Plus
CG17999-RA 1638 CG17999-PA 1223..1442 1293..1512 290 75.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:49 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG9993-RA 1802 CG9993-RA 5..1802 1..1798 8960 99.9 Plus
CG17999-RA 1691 CG17999-RA 1259..1478 1293..1512 290 75.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG9993-PA 543 CG9993-PA 1..543 74..1702 2851 100 Plus
CG17999-PA 545 CG17999-PA 7..533 89..1669 1550 55.9 Plus
CG11453-PA 539 CG11453-PA 4..526 77..1678 791 35.9 Plus
CG8834-PA 535 CG8834-PA 3..521 74..1663 751 34.3 Plus
CG4830-PA 534 CG4830-PA 8..521 89..1663 742 35 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20850136..20851208 1808..736 5320 99.7 Minus
2R 25286936 2R 20851706..20852121 416..1 2065 99.8 Minus
2R 25286936 2R 20851449..20851648 615..416 1000 100 Minus
2R 25286936 2R 20851267..20851386 735..616 600 100 Minus
2R 25286936 2R 20848193..20848412 1512..1293 290 75.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20851335..20852407 1808..736 5320 99.7 Minus
2R 25260384 2R 20852905..20853320 416..1 2065 99.7 Minus
2R 25260384 2R 20852648..20852847 615..416 1000 100 Minus
2R 25260384 2R 20852466..20852585 735..616 600 100 Minus
2R 25260384 2R 20849482..20849611 1422..1293 230 78.4 Minus
2R 25260384 2R 20850768..20850868 405..305 145 76.2 Minus
Blast to na_te.dros performed on 2014-11-26 23:15:41 has no hits.

FI01812.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:26:44 Download gff for FI01812.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16738292..16738707 1..416 99   Minus
chr2R 16738035..16738233 417..615 100 <- Minus
chr2R 16737853..16737972 616..735 100 <- Minus
chr2R 16736732..16737794 736..1798 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:49:32 Download gff for FI01812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9993-RA 1..1632 74..1705 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:51:08 Download gff for FI01812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9993-RA 1..1632 74..1705 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:38 Download gff for FI01812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9993-RA 1..1632 74..1705 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:26:44 Download gff for FI01812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9993-RA 1..1632 74..1705 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-08 10:15:17 Download gff for FI01812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9993-RA 1..1798 1..1798 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:51:08 Download gff for FI01812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9993-RA 1..1798 1..1798 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:38 Download gff for FI01812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9993-RA 5..1802 1..1798 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:26:44 Download gff for FI01812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9993-RA 5..1802 1..1798 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:26:44 Download gff for FI01812.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20851706..20852121 1..416 99   Minus
2R 20851449..20851647 417..615 100 <- Minus
2R 20851267..20851386 616..735 100 <- Minus
2R 20850146..20851208 736..1798 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:38 Download gff for FI01812.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16739211..16739626 1..416 99   Minus
arm_2R 16738954..16739152 417..615 100 <- Minus
arm_2R 16738772..16738891 616..735 100 <- Minus
arm_2R 16737651..16738713 736..1798 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:27:09 Download gff for FI01812.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20852905..20853320 1..416 99   Minus
2R 20852648..20852846 417..615 100 <- Minus
2R 20852466..20852585 616..735 100 <- Minus
2R 20851345..20852407 736..1798 99 <- Minus

FI01812.pep Sequence

Translation from 1 to 1704

> FI01812.pep
VYVYESCVLSNRTAKRNPERRESQMASTKYDSFEKIWSGPKDKEYYGPDM
TLGEVALIILRLYSDKVMQVYDPTGEELTGSQLLEQSRRLAHAFQRLKLQ
RGDVVGISAKNTTYLTEVVIAALLNGTPINPLHPDFDAETTAYMFEITKP
KVIFCDLDNYQTLSAVKSSLKFKTEIILLTGTLPGVRNIQDLLADGCTGY
DEKTLFACPHLCGDDTAFIITSSGVTGLPKGVTRSHRSLLNSAKIPQLFT
SDTVLFCFSPLYWISCIFTLLASLVNGCRRIITNRPFSVAYFADLVERHQ
VSFVLTVPHHMALLAKSPERQELAAKMQCVQSFVCSGSKVPMGIWRQLYE
LLGANRFAVLYGLTETGGISKNVGGPLGSEGRLLRNVQVRVVDPHGQSLG
PNQTGQILVRLNLRWGGYYHNPQETQVTVTPDGKWLLTGDHGYFDDEGCL
HFQSRDTDVFKYNHFPIYPKQIEDVILHLPGVHEVAVFGIPDEVSTNLTA
CAVVRNEDELGAQLTEADVKGVVAQHLSDAFHIRGGVFFVDNLPKTQNSK
VQRRKIWSQLSEATTHL*

FI01812.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12739-PA 543 GF12739-PA 1..543 25..567 2600 86.9 Plus
Dana\GF12740-PA 547 GF12740-PA 7..534 30..557 1607 55.7 Plus
Dana\GF17617-PA 539 GF17617-PA 5..526 27..559 811 35.5 Plus
Dana\GF17741-PA 533 GF17741-PA 8..521 30..554 795 36.5 Plus
Dana\GF12065-PA 536 GF12065-PA 6..528 28..560 786 35.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20824-PA 543 GG20824-PA 1..543 25..567 2816 95.9 Plus
Dere\GG20826-PA 545 GG20826-PA 7..539 30..562 1566 54 Plus
Dere\GG22584-PA 535 GG22584-PA 2..521 24..554 788 36.1 Plus
Dere\GG22583-PA 535 GG22583-PA 3..521 25..554 769 34.2 Plus
Dere\GG23505-PA 539 GG23505-PA 4..526 26..559 755 35 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19879-PA 544 GH19879-PA 1..537 25..562 2141 71.4 Plus
Dgri\GH19881-PA 549 GH19881-PA 4..537 23..556 1518 52.5 Plus
Dgri\GH21197-PA 532 GH21197-PA 6..522 28..555 818 36.1 Plus
Dgri\GH15631-PA 537 GH15631-PA 7..523 28..553 761 33 Plus
Dgri\GH15849-PA 540 GH15849-PA 6..527 27..559 759 34.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG9993-PA 543 CG9993-PA 1..543 25..567 2851 100 Plus
CG17999-PA 545 CG17999-PA 7..533 30..556 1550 55.9 Plus
CG11453-PA 539 CG11453-PA 4..526 26..559 791 35.9 Plus
CG8834-PA 535 CG8834-PA 3..521 25..554 751 34.3 Plus
CG4830-PA 534 CG4830-PA 8..521 30..554 742 35 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19829-PA 544 GI19829-PA 1..537 25..562 2377 77.9 Plus
Dmoj\GI19830-PA 546 GI19830-PA 8..534 30..556 1567 54.5 Plus
Dmoj\GI20482-PA 532 GI20482-PA 6..521 28..554 805 35.3 Plus
Dmoj\GI21292-PA 535 GI21292-PA 3..520 28..556 762 33.5 Plus
Dmoj\GI22427-PA 540 GI22427-PA 6..527 27..559 758 34.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17419-PA 545 GL17419-PA 1..545 25..567 2526 84 Plus
Dper\GL17420-PA 545 GL17420-PA 7..533 30..556 1594 56.4 Plus
Dper\GL21570-PA 533 GL21570-PA 8..521 30..554 815 36.3 Plus
Dper\GL12674-PA 523 GL12674-PA 2..510 24..559 763 34.6 Plus
Dper\GL10440-PA 535 GL10440-PA 3..521 25..554 753 34.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22173-PA 545 GA22173-PA 1..545 25..567 2529 84.2 Plus
Dpse\GA14760-PA 545 GA14760-PA 7..533 30..556 1593 56.2 Plus
Dpse\GA18463-PA 533 GA18463-PA 8..521 30..554 813 36.3 Plus
Dpse\GA27586-PA 539 GA27586-PA 2..526 24..559 795 35 Plus
Dpse\GA21356-PA 535 GA21356-PA 3..521 25..554 760 34.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15771-PA 543 GM15771-PA 1..543 25..567 2856 97.4 Plus
Dsec\GM15772-PA 544 GM15772-PA 7..532 30..556 1597 55.8 Plus
Dsec\GM20364-PA 535 GM20364-PA 6..521 28..554 812 37 Plus
Dsec\GM20876-PA 539 GM20876-PA 4..526 26..559 800 35.5 Plus
Dsec\GM20363-PA 535 GM20363-PA 3..521 25..554 751 33.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25247-PA 543 GD25247-PA 1..543 25..567 2877 98.2 Plus
Dsim\GD25248-PA 545 GD25248-PA 7..533 30..556 1592 55.6 Plus
Dsim\GD19314-PA 539 GD19314-PA 4..526 26..559 806 35.7 Plus
Dsim\GD25844-PA 534 GD25844-PA 2..521 24..554 802 36.4 Plus
Dsim\GD25845-PA 535 GD25845-PA 2..521 24..554 792 36.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18629-PA 544 GJ18629-PA 1..544 25..567 2396 79.1 Plus
Dvir\GJ18640-PA 548 GJ18640-PA 11..536 30..556 1565 54.9 Plus
Dvir\GJ22332-PA 532 GJ22332-PA 6..521 28..554 801 35.2 Plus
Dvir\GJ22334-PA 533 GJ22334-PA 1..529 25..563 797 35.2 Plus
Dvir\GJ10988-PA 540 GJ10988-PA 6..527 27..559 776 35 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22879-PA 543 GK22879-PA 1..543 25..567 2398 79.7 Plus
Dwil\GK22880-PA 545 GK22880-PA 4..539 27..562 1588 55.3 Plus
Dwil\GK22355-PA 541 GK22355-PA 2..528 24..559 762 33.7 Plus
Dwil\GK21395-PA 533 GK21395-PA 3..523 23..554 758 33.2 Plus
Dwil\GK11566-PA 532 GK11566-PA 6..520 28..554 755 33.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13765-PA 543 GE13765-PA 1..543 25..567 2803 95.4 Plus
Dyak\GE13766-PA 545 GE13766-PA 7..533 30..556 1593 55.8 Plus
Dyak\GE13453-PA 535 GE13453-PA 2..521 24..554 814 36.4 Plus
Dyak\GE13452-PA 672 GE13452-PA 2..520 24..554 800 35.4 Plus
Dyak\GE13451-PA 535 GE13451-PA 3..521 25..554 769 34.2 Plus

FI01812.hyp Sequence

Translation from 1 to 1704

> FI01812.hyp
VDVYESCVLSNRTAKRNPERRESQMASTKYDSFEKIWSGPKDKEYYGPDM
TLGEVALIILRLYSDKVMQVYDPTGEELTGSQLLEQSRRLAHAFQRLKLQ
RGDVVGISAKNTTYLTEVVIAALLNGTPINPLHPDFDAETTAYMFEITKP
KVIFCDLDNYQTLSAVKSSLKFKTEIILLTGTLPGVRNIQDLLADGCTGY
DEKTLFACPHLCGDDTAFIITSSGVTGLPKGVTRSHRSLLNSAKIPQLFT
SDTVLFCFSPLYWISCIFTLLASLVNGCRRIITNRPFSVAYFADLVERHQ
VSFVLTVPHHMALLAKSPERQELAAKMQCVQSFVCSGSKVPMGIWRQLYE
LLGANRFAVLYGLTETGGISKNVGGPLGSEGRLLRNVQVRVVDPHGQSLG
PNQTGQILVRLNLRWGGYYHNPQETQVTVTPDGKWLLTGDHGYFDDEGCL
HFQSRDTDVFKYNHFPIYPKQIEDVILHLPGVHEVAVFGIPDEVSTNLTA
CAVVRNEDELGAQLTEADVKGVVAQHLSDAFHIRGGVFFVDNLPKTQNSK
VQRRKIWSQLSEATTHL*

FI01812.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG9993-PA 543 CG9993-PA 1..543 25..567 2851 100 Plus
CG17999-PA 545 CG17999-PA 7..533 30..556 1550 55.9 Plus
CG11453-PA 539 CG11453-PA 4..526 26..559 791 35.9 Plus
CG8834-PA 535 CG8834-PA 3..521 25..554 751 34.3 Plus
CG4830-PA 534 CG4830-PA 8..521 30..554 742 35 Plus