Clone FI01817 Report

Search the DGRC for FI01817

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:18
Well:17
Vector:pFlc-1
Associated Gene/TranscriptCG8563-RA
Protein status:FI01817.pep: gold
Sequenced Size:1801

Clone Sequence Records

FI01817.complete Sequence

1801 bp assembled on 2009-08-13

GenBank Submission: BT099578.1

> FI01817.complete
AGTCTTCCGCCGGACCGGAGATGGAACGCACGGATCGCGTCCGCTGAACA
GAGTTTCTTTTAGTATTATAATATTTTCCCCCAAGCTAATCACTTAAAAC
TAAGAGCTCTTGAAGAACTGAAACTCTTACCCAATCGGCGTCAGTGTGCA
GCGTGCAAACAATAAAACAAACAAACAGCCAAACAAAAGTGCAAAAAAAA
AAAAAATCAACAAAAAATCTTACAAATACGTGCGGCTGTCCATGCAACAG
CATATTTTAATACATAATTAGCCAGAGATCGTGGAAGCATCTCGGTGCAT
GTGCACAGTATATACAGTATATATATATAAAATTTACATATAATTGGTAA
AAATGTGGCAGGGAATCGTGTGCAGCTTGGCTTTATGCCTCGTCGGATTG
GCGGGTCTCGGCATCGCCAACAATCTCGCCGGCTACGAAGGTTATACAAA
ATACACGGTGCAACATGGAGACGAGAATGCCTTCAAGTACATGGTCGACC
TGCAGACGAATGACGCGGAGCTGGACTTTTGGTTGCTGACCAGAAACTCC
TCCGTGCTGACAGTGAGTCCCCGGCGGAAGACACAGTTCGAGGCGAGTCT
TTCCAGTTTGGGAGTTAGCTACGAGATGCAGCCGCTCATGGAGCTGATGG
CGGCCCTTCAAGCGAACAGTTCCTTTGCGGATGACAACTACGATGGGGAG
TACGAGGAGTGCCAGCAGGATGAGTGCGAGCAGGCGGAGCGACCACGTCG
AAGGACTCGTCGTCAGGCTCGCGGCTTCTTCTCGCACTATCCGCGGTATC
ATGAGGTGCTCAGCTTCATGAGTGGCTTGGCCGCCAGATATCCTCAGTTC
TGCCGCTATGAATCCTTGGGTCGTTCCAACGAGGGTCGCCACATAGCTGC
TCTCTCTATTTCACTGAACAGTAGGGTACGTCCTCGTCGAGTGGCCTATA
TCCAGGCAGCCACCCACGGTAGGGAGTGGATTACTACGCAGACCGTTCTC
TACTTGGCCTACGAACTGCTGAGCAATCTGCGCGCCTTCACGAGGGTCCT
GCAGGATGTGGAGATCTTTCTGGTGCCGCTGGTCAATCCCGATGGCTATG
AATACACGCACACAACGGATCGTTTCTGGCGCAAGAACCGTCATCGTTAT
GCGGGTCATTCCTGCTCCGGCGTGGACATCAATCGTAACTTTGGCAATCA
CTGGAACTATCAGGGAGCCAGCCAGAACCTCTGCTCGGAGGTGTACTCGG
GCACTGCGCCCAATTCGGAGCCGGAGACCTCGGCGGTGGTGCGGTATCTG
GAATTCAATCGAAACCGTGTGAAACTCAGCCTGGATGTTCACTCATTTGG
CAAATTCATTTTTTATCCCTACGGCTATGCGAAAAACACCGTGCCACCAA
CCGTGGGAACGCTGCGCTCGGTGGCTCTGAGGGCCGCCAACCAGATCGGC
AGGTACCGTGGAACGCGCTACACCACCGGCACCTCCGCCTCCATTTTGTA
CGAGGCCTCCGGCAGCTTGGACGACTTCGCCTATGGCAATCTGGGAATCC
CGCTGTCCTACACGCTCGAGCTGCCCGGTGACGAGTTCCATGTGCCCGCC
CACGACATCATCCACGTCTGCAAGGAGACATTCGCCGGCTTCATCGAGTT
CATCCGGCACGTCAGCCTTTACTAGAAGGCGCCACTGTATTTCCTAAGCC
CTAAAGCAATTGAATTTATTGTTTGTTAAAAACTAAAATTATAAGTCACC
TCGTTGTTAAGCATTAAAGAGATGAATAGTGAATAAAAAAAAAAAAAAAA
A

FI01817.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:30:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG8563.a 2156 CG8563.a 338..2124 1..1787 8920 99.9 Plus
CG8563-RA 1822 CG8563-RA 1..1787 1..1787 8920 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7385699..7386376 441..1118 3330 99.4 Plus
chr3L 24539361 chr3L 7383186..7383626 1..441 2175 99.5 Plus
chr3L 24539361 chr3L 7387722..7388122 1384..1784 1990 99.8 Plus
chr3L 24539361 chr3L 7387045..7387199 1229..1383 775 100 Plus
chr3L 24539361 chr3L 7386846..7386957 1117..1228 560 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG8563-RB 1323 CG8563-PB 1..1323 353..1675 6600 99.9 Plus
CG8563-RA 1323 CG8563-PA 1..1323 353..1675 6600 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:53 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG8563-RB 2121 CG8563-RB 338..2121 1..1784 8905 99.9 Plus
CG8563-RA 1786 CG8563-RA 3..1786 1..1784 8905 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:08:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG8563-PB 440 CG8563-PB 1..440 353..1672 1988 100 Plus
CG8563-PA 440 CG8563-PA 1..440 353..1672 1988 100 Plus
CG8560-PB 418 CG8560-PB 21..406 434..1639 475 32.4 Plus
CG8560-PA 418 CG8560-PA 21..406 434..1639 475 32.4 Plus
CG18417-PA 427 CG18417-PA 127..420 788..1663 474 38.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7393592..7394269 441..1118 3375 99.9 Plus
3L 28110227 3L 7391079..7391519 1..441 2205 100 Plus
3L 28110227 3L 7395613..7396016 1384..1787 2020 100 Plus
3L 28110227 3L 7394936..7395090 1229..1383 775 100 Plus
3L 28110227 3L 7394737..7394848 1117..1228 560 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:26:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7386692..7387369 441..1118 3375 99.8 Plus
3L 28103327 3L 7384179..7384619 1..441 2205 100 Plus
3L 28103327 3L 7388713..7389116 1384..1787 2020 100 Plus
3L 28103327 3L 7388036..7388190 1229..1383 775 100 Plus
3L 28103327 3L 7387837..7387948 1117..1228 560 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:08:09 has no hits.

FI01817.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:36:40 Download gff for FI01817.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7387722..7388122 1384..1784 99   Plus
chr3L 7387045..7387199 1229..1383 100 -> Plus
chr3L 7386847..7386957 1118..1228 100 -> Plus
chr3L 7385700..7386375 442..1117 99 -> Plus
chr3L 7383414..7383626 229..441 86 -> Plus
chr3L 7383186..7383340 1..155 99 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:14:01 Download gff for FI01817.complete
Subject Subject Range Query Range Percent Splice Strand
CG8563-RA 1..1323 353..1675 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:58:34 Download gff for FI01817.complete
Subject Subject Range Query Range Percent Splice Strand
CG8563-RA 1..1323 353..1675 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:37:58 Download gff for FI01817.complete
Subject Subject Range Query Range Percent Splice Strand
CG8563-RA 1..1323 353..1675 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:36:40 Download gff for FI01817.complete
Subject Subject Range Query Range Percent Splice Strand
CG8563-RA 1..1323 353..1675 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-13 10:19:53 Download gff for FI01817.complete
Subject Subject Range Query Range Percent Splice Strand
CG8563-RA 1..1784 1..1784 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:58:33 Download gff for FI01817.complete
Subject Subject Range Query Range Percent Splice Strand
CG8563-RA 1..1784 1..1784 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:37:58 Download gff for FI01817.complete
Subject Subject Range Query Range Percent Splice Strand
CG8563-RA 3..1786 1..1784 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:36:40 Download gff for FI01817.complete
Subject Subject Range Query Range Percent Splice Strand
CG8563-RA 3..1786 1..1784 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:36:40 Download gff for FI01817.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7395613..7396013 1384..1784 100   Plus
3L 7394936..7395090 1229..1383 100 -> Plus
3L 7394738..7394848 1118..1228 100 -> Plus
3L 7393593..7394268 442..1117 99 -> Plus
3L 7391079..7391519 1..441 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:37:58 Download gff for FI01817.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7388713..7389113 1384..1784 100   Plus
arm_3L 7388036..7388190 1229..1383 100 -> Plus
arm_3L 7387838..7387948 1118..1228 100 -> Plus
arm_3L 7386693..7387368 442..1117 99 -> Plus
arm_3L 7384179..7384619 1..441 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:50:13 Download gff for FI01817.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7388713..7389113 1384..1784 100   Plus
3L 7388036..7388190 1229..1383 100 -> Plus
3L 7387838..7387948 1118..1228 100 -> Plus
3L 7386693..7387368 442..1117 99 -> Plus
3L 7384179..7384619 1..441 100 -> Plus

FI01817.pep Sequence

Translation from 352 to 1674

> FI01817.pep
MWQGIVCSLALCLVGLAGLGIANNLAGYEGYTKYTVQHGDENAFKYMVDL
QTNDAELDFWLLTRNSSVLTVSPRRKTQFEASLSSLGVSYEMQPLMELMA
ALQANSSFADDNYDGEYEECQQDECEQAERPRRRTRRQARGFFSHYPRYH
EVLSFMSGLAARYPQFCRYESLGRSNEGRHIAALSISLNSRVRPRRVAYI
QAATHGREWITTQTVLYLAYELLSNLRAFTRVLQDVEIFLVPLVNPDGYE
YTHTTDRFWRKNRHRYAGHSCSGVDINRNFGNHWNYQGASQNLCSEVYSG
TAPNSEPETSAVVRYLEFNRNRVKLSLDVHSFGKFIFYPYGYAKNTVPPT
VGTLRSVALRAANQIGRYRGTRYTTGTSASILYEASGSLDDFAYGNLGIP
LSYTLELPGDEFHVPAHDIIHVCKETFAGFIEFIRHVSLY*

FI01817.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10640-PA 440 GF10640-PA 1..440 1..440 2075 90.7 Plus
Dana\GF23789-PA 417 GF23789-PA 21..413 28..437 558 32.4 Plus
Dana\GF10643-PA 428 GF10643-PA 6..421 12..437 503 32.1 Plus
Dana\GF23551-PA 416 GF23551-PA 1..407 1..434 481 29.1 Plus
Dana\GF23552-PA 416 GF23552-PA 1..407 1..434 478 29.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14422-PA 440 GG14422-PA 1..440 1..440 2101 95.2 Plus
Dere\GG14964-PA 418 GG14964-PA 21..415 28..438 526 31.5 Plus
Dere\GG14425-PA 427 GG14425-PA 107..420 134..437 522 37.5 Plus
Dere\GG14391-PA 416 GG14391-PA 6..407 11..434 497 29.7 Plus
Dere\GG18471-PA 447 GG18471-PA 136..408 134..407 486 37.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:21:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14880-PA 437 GH14880-PA 1..437 1..440 1952 82.8 Plus
Dgri\GH16615-PA 418 GH16615-PA 3..414 5..437 579 33.5 Plus
Dgri\GH14883-PA 424 GH14883-PA 5..417 1..437 506 31 Plus
Dgri\GH24581-PA 1065 GH24581-PA 730..1017 132..419 501 37.7 Plus
Dgri\GH14882-PA 423 GH14882-PA 21..412 27..430 496 32.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG8563-PB 440 CG8563-PB 1..440 1..440 2331 100 Plus
CG8563-PA 440 CG8563-PA 1..440 1..440 2331 100 Plus
CG8560-PB 418 CG8560-PB 2..406 9..429 545 32.6 Plus
CG8560-PA 418 CG8560-PA 2..406 9..429 545 32.6 Plus
CG18417-PA 427 CG18417-PA 108..420 135..437 500 37.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12853-PA 445 GI12853-PA 1..445 1..440 1924 80.6 Plus
Dmoj\GI12460-PA 419 GI12460-PA 3..408 9..430 539 32.1 Plus
Dmoj\GI12857-PA 402 GI12857-PA 72..389 122..437 514 36.4 Plus
Dmoj\GI12859-PA 423 GI12859-PA 109..416 132..437 502 37 Plus
Dmoj\GI12855-PA 396 GI12855-PA 15..389 57..437 498 32.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26374-PA 438 GL26374-PA 1..438 1..440 2085 89.1 Plus
Dper\GL24275-PA 418 GL24275-PA 1..404 5..427 529 32.9 Plus
Dper\GL26418-PA 424 GL26418-PA 125..417 142..437 524 37.7 Plus
Dper\GL15219-PA 1131 GL15219-PA 808..1107 134..431 488 37.7 Plus
Dper\GL15222-PA 469 GL15222-PA 85..417 61..407 464 32.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:21:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21166-PA 438 GA21166-PA 1..438 1..440 2085 89.1 Plus
Dpse\GA21163-PA 418 GA21163-PA 1..414 5..437 551 32.9 Plus
Dpse\GA14928-PA 424 GA14928-PA 125..417 142..437 520 37.7 Plus
Dpse\GA21165-PA 425 GA21165-PA 23..414 27..430 490 32 Plus
Dpse\GA13272-PA 416 GA13272-PA 6..407 11..434 473 28.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14839-PA 440 GM14839-PA 1..440 1..440 2240 97.5 Plus
Dsec\GM13761-PA 418 GM13761-PA 1..415 6..438 540 31.7 Plus
Dsec\GM14842-PA 336 GM14842-PA 62..329 172..437 485 39.5 Plus
Dsec\GM14804-PA 416 GM14804-PA 6..407 11..434 478 28.8 Plus
Dsec\GM14841-PA 424 GM14841-PA 4..413 8..430 476 31.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:21:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14012-PA 440 GD14012-PA 1..440 1..440 2253 97.7 Plus
Dsim\GD13057-PA 418 GD13057-PA 1..415 6..438 535 32.3 Plus
Dsim\GD14015-PA 427 GD14015-PA 107..420 134..437 501 36.6 Plus
Dsim\GD16233-PA 427 GD16233-PA 115..388 133..407 488 37.4 Plus
Dsim\GD14014-PA 424 GD14014-PA 4..413 8..430 471 30.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12997-PA 437 GJ12997-PA 1..437 1..440 1984 85.3 Plus
Dvir\GJ12361-PA 419 GJ12361-PA 15..415 21..437 553 32.4 Plus
Dvir\GJ14824-PA 988 GJ14824-PA 662..967 134..439 507 37.7 Plus
Dvir\GJ13000-PA 424 GJ13000-PA 116..417 138..437 498 37 Plus
Dvir\GJ12999-PA 423 GJ12999-PA 22..412 28..430 479 32.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:21:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17379-PA 448 GK17379-PA 1..448 1..440 1981 84.6 Plus
Dwil\GK16806-PA 418 GK16806-PA 12..414 12..437 555 31.6 Plus
Dwil\GK17382-PA 426 GK17382-PA 106..419 126..437 491 35.8 Plus
Dwil\GK12561-PA 417 GK12561-PA 5..408 11..434 483 29.1 Plus
Dwil\GK23952-PA 418 GK23952-PA 3..409 6..434 479 29.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21613-PA 440 GE21613-PA 1..440 1..440 2156 96.4 Plus
Dyak\GE20414-PA 418 GE20414-PA 1..415 6..438 533 31.5 Plus
Dyak\GE21616-PA 427 GE21616-PA 127..420 146..437 514 37.4 Plus
Dyak\GE16788-PA 444 GE16788-PA 133..405 134..407 483 36.8 Plus
Dyak\GE21615-PA 424 GE21615-PA 4..413 8..430 473 31.4 Plus

FI01817.hyp Sequence

Translation from 352 to 1674

> FI01817.hyp
MWQGIVCSLALCLVGLAGLGIANNLAGYEGYTKYTVQHGDENAFKYMVDL
QTNDAELDFWLLTRNSSVLTVSPRRKTQFEASLSSLGVSYEMQPLMELMA
ALQANSSFADDNYDGEYEECQQDECEQAERPRRRTRRQARGFFSHYPRYH
EVLSFMSGLAARYPQFCRYESLGRSNEGRHIAALSISLNSRVRPRRVAYI
QAATHGREWITTQTVLYLAYELLSNLRAFTRVLQDVEIFLVPLVNPDGYE
YTHTTDRFWRKNRHRYAGHSCSGVDINRNFGNHWNYQGASQNLCSEVYSG
TAPNSEPETSAVVRYLEFNRNRVKLSLDVHSFGKFIFYPYGYAKNTVPPT
VGTLRSVALRAANQIGRYRGTRYTTGTSASILYEASGSLDDFAYGNLGIP
LSYTLELPGDEFHVPAHDIIHVCKETFAGFIEFIRHVSLY*

FI01817.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8563-PB 440 CG8563-PB 1..440 1..440 2331 100 Plus
CG8563-PA 440 CG8563-PA 1..440 1..440 2331 100 Plus
CG8560-PB 418 CG8560-PB 2..406 9..429 545 32.6 Plus
CG8560-PA 418 CG8560-PA 2..406 9..429 545 32.6 Plus
CG18417-PA 427 CG18417-PA 108..420 135..437 500 37.3 Plus