Clone FI01822 Report

Search the DGRC for FI01822

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:18
Well:22
Vector:pFlc-1
Associated Gene/TranscriptCG31300-RA
Protein status:FI01822.pep: gold
Sequenced Size:1487

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31300 2008-04-29 Release 5.5 accounting
CG31300 2008-08-15 Release 5.9 accounting
CG31300 2008-12-18 5.12 accounting

Clone Sequence Records

FI01822.complete Sequence

1487 bp assembled on 2007-09-06

GenBank Submission: BT030805

> FI01822.complete
ATAATAAACTACAACGCCACTCAGAATAGTCGTGGCACTTATCTACTAGA
TTGTGCAACAGCGAGCAATATGACTGACAAGTTAGATGCGGAACAATTTA
ACGACGACGAACTAGAGGCACCTGCTTGGCTGAATCGTCAATTTATAGAG
GAAATTCTGAGCGCGTACGAAGATTCCCCGGAACTAAAAGTTGTCGATCT
TAAAATCACACCCGCAAGTGCCCAGGGAGATCACTATGCCAGCGTTATGT
TCCGAACAACTGCAGAGTGTACCACCGCGAAGGGAAAGTTCAGTAGGCCA
CTAATCATCAAGGCGATGCCCGAGCAGGATGGACACAAGAAGGATATGCT
CAGCGAATCGCATCTATTCGAAACCGAGATCGGAATGTACTGCCAGGTTC
TTCCGGAATTCGAGAGAATTCTGCGGGAATCCGGAGACGATACAAAGCTA
TTTGTTCCCTGCATTTACCATAGCCTGGAGCCGCGTAAGGTGATGATATT
TGAGGACCTTGTGCCCCAGGGATATTATGTCATTCGAGACCGTCCGGTTG
CTCAGGAAGAACTCAAAACAGCCTTTGCTAAACTGGCCAAATGGCATGCA
ATTAGCATGAAATACATTAAGGAGCAACCTGACTTCCTAAAGGAGTTTAA
GTATGGCCTCTTCGAGATGCCCACTGTAAAGACCGACCCTTTTATTACAA
CTGGCATGCAGAGCTTCATTGAAATGCTGGACAGATTACCAGAGCTAAGA
AAGTATAAGCCTCATTTCGAAAAGATAAAAGATAAGTACATGCAACGACT
ACAAGCTGTGATGAAGGAATACCATGAAAATCGAAAGAGTGATGCCTTCT
ATGTCCTCTGTCATGGTGACTTCCATCTTCGCAATATGATGTTCAAGAAC
AACAAGGGGACGGGAGCCCACGAGGATACCATGCTGGTGGATTTCCAGAT
TAGCAACCTTTGTCCCATCACAATTGATCTCACATATTCCATCTATATGC
TGATGGAGCCGGAACAACGCAGAGAAATGGGAAAGGACTTGATTAATCAC
TACTTAACCGTTTTGGTTGCCACCCTCAAGAGCATTGGATACCCAGGTGA
ACTGCCAACCCAAGCGAAACTCTGGGATGAAATCCATAAGAACAAGTATT
ATGATTTCTTTTTGTTGAGCACTTTTCTGCCCTTGATTTTGGCCATCAAA
TCGAAGAGTTTTAAAGTGAACGACCTTATACAGGATCCGGAAACCCGCCA
AAAAACCTACTTTTTGGATACATATGTTAAAGATGTTTCCAAACTATTGC
CGAAATTCGAGCAACTTGGCTACTTTAAATGTCTATAGCTCTCATTTATT
TACATAAATATGTTGCCCTTATTTTGTTTATTCCATTATTTTGTTTTCCG
GTTGAAATACATATGTACATAAGTACTTACGAAAGGAACATTTCTTCCAA
TAAAAGATTATTACTGAAACATAAAAAAAAAAAAAAA

FI01822.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG31300-RA 1574 CG31300-RA 93..1568 1..1476 7365 99.9 Plus
CG31104-RA 1393 CG31104-RA 579..817 583..821 505 80.7 Plus
CG31104-RA 1393 CG31104-RA 276..517 280..521 475 79.7 Plus
CG11893-RA 1433 CG11893-RA 159..361 178..380 475 82.2 Plus
CG31104-RA 1393 CG31104-RA 948..1174 952..1178 385 77.9 Plus
CG11893-RA 1433 CG11893-RA 376..526 395..545 305 80.1 Plus
CG31104-RA 1393 CG31104-RA 102..250 106..254 265 78.5 Plus
CG31104-RA 1393 CG31104-RA 845..919 849..923 195 84 Plus
CG11893-RA 1433 CG11893-RA 561..637 580..656 175 81.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21106718..21107341 1..624 3120 100 Plus
chr3R 27901430 chr3R 21107401..21107931 623..1153 2610 99.4 Plus
chr3R 27901430 chr3R 21108001..21108320 1153..1472 1600 100 Plus
chr3R 27901430 chr3R 21109231..21109761 623..1153 795 76.6 Plus
chr3R 27901430 chr3R 21113047..21113744 94..791 790 74.2 Plus
chr3R 27901430 chr3R 21108659..21109074 106..521 685 77.6 Plus
chr3R 27901430 chr3R 21127468..21127757 217..506 310 73.8 Plus
chr3R 27901430 chr3R 21110734..21111054 223..543 300 72.9 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG31300-RA 1269 CG31300-PA 1..1269 70..1338 6345 100 Plus
CG31104-RA 1263 CG31104-PA 31..1103 106..1178 1525 76.1 Plus
CG11893-RA 1251 CG11893-PA 15..722 84..791 810 74.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:58 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG31300-RA 1474 CG31300-RA 3..1474 1..1472 7360 100 Plus
CG31104-RA 1382 CG31104-RA 91..1163 106..1178 1525 76.1 Plus
CG11893-RA 1415 CG11893-RA 53..760 84..791 810 74.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG31300-PA 422 CG31300-PA 1..422 70..1335 2226 100 Plus
CG31104-PA 420 CG31104-PA 7..420 94..1335 1647 72.2 Plus
CG11893-PA 416 CG11893-PA 1..416 70..1335 1587 67.8 Plus
CG13658-PB 422 CG13658-PB 1..422 70..1335 1440 62.6 Plus
CG31436-PA 420 CG31436-PA 9..416 94..1320 1233 55.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25283622..25284245 1..624 3120 100 Plus
3R 32079331 3R 25284305..25284835 623..1153 2655 100 Plus
3R 32079331 3R 25284905..25285228 1153..1476 1605 99.7 Plus
3R 32079331 3R 25286135..25286665 623..1153 810 76.8 Plus
3R 32079331 3R 25289941..25290648 84..791 810 74.3 Plus
3R 32079331 3R 25285563..25285978 106..521 685 77.6 Plus
3R 32079331 3R 25304361..25304650 217..506 310 73.8 Plus
3R 32079331 3R 25287638..25287958 223..543 300 72.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25024453..25025076 1..624 3120 100 Plus
3R 31820162 3R 25025136..25025666 623..1153 2655 100 Plus
3R 31820162 3R 25025736..25026059 1153..1476 1605 99.6 Plus
3R 31820162 3R 25026568..25026809 280..521 475 79.7 Plus
3R 31820162 3R 25030866..25031068 178..380 475 82.2 Plus
3R 31820162 3R 25026966..25027164 623..821 425 80.9 Plus
3R 31820162 3R 25027295..25027496 952..1153 320 77.2 Plus
3R 31820162 3R 25031083..25031233 395..545 305 80.1 Plus
3R 31820162 3R 25026394..25026542 106..254 265 78.5 Plus
3R 31820162 3R 25028611..25028789 365..543 220 74.8 Plus
3R 31820162 3R 25045279..25045391 304..416 205 78.7 Plus
3R 31820162 3R 25027192..25027266 849..923 195 84 Plus
3R 31820162 3R 25031268..25031344 580..656 175 81.8 Plus
3R 31820162 3R 25041866..25041911 206..251 140 86.9 Plus
Blast to na_te.dros performed on 2014-11-27 14:27:39 has no hits.

FI01822.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:12:16 Download gff for FI01822.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21108002..21108320 1154..1472 100   Plus
chr3R 21107403..21107931 625..1153 99 -> Plus
chr3R 21106718..21107341 1..624 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:39 Download gff for FI01822.complete
Subject Subject Range Query Range Percent Splice Strand
CG31300-RA 1..1269 70..1338 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:23:15 Download gff for FI01822.complete
Subject Subject Range Query Range Percent Splice Strand
CG31300-RA 1..1269 70..1338 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:50:59 Download gff for FI01822.complete
Subject Subject Range Query Range Percent Splice Strand
CG31300-RA 1..1269 70..1338 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:44 Download gff for FI01822.complete
Subject Subject Range Query Range Percent Splice Strand
CG31300-RA 1..1269 70..1338 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:12:16 Download gff for FI01822.complete
Subject Subject Range Query Range Percent Splice Strand
CG31300-RA 1..1269 70..1338 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:40:00 Download gff for FI01822.complete
Subject Subject Range Query Range Percent Splice Strand
CG31300-RA 1..1472 1..1472 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:23:15 Download gff for FI01822.complete
Subject Subject Range Query Range Percent Splice Strand
CG31300-RA 1..1472 1..1472 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:50:59 Download gff for FI01822.complete
Subject Subject Range Query Range Percent Splice Strand
CG31300-RA 3..1474 1..1472 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:44 Download gff for FI01822.complete
Subject Subject Range Query Range Percent Splice Strand
CG31300-RA 1..1472 1..1472 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:12:16 Download gff for FI01822.complete
Subject Subject Range Query Range Percent Splice Strand
CG31300-RA 3..1474 1..1472 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:12:16 Download gff for FI01822.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25284906..25285224 1154..1472 100   Plus
3R 25284307..25284835 625..1153 100 -> Plus
3R 25283622..25284245 1..624 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:50:59 Download gff for FI01822.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21110628..21110946 1154..1472 100   Plus
arm_3R 21110029..21110557 625..1153 100 -> Plus
arm_3R 21109344..21109967 1..624 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:55:07 Download gff for FI01822.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25025737..25026055 1154..1472 100   Plus
3R 25025138..25025666 625..1153 100 -> Plus
3R 25024453..25025076 1..624 100 -> Plus

FI01822.hyp Sequence

Translation from 1 to 1337

> FI01822.hyp
IINYNATQNSRGTYLLDCATASNMTDKLDAEQFNDDELEAPAWLNRQFIE
EILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAECTTAKGKFSRP
LIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKL
FVPCIYHSLEPRKVMIFEDLVPQGYYVIRDRPVAQEELKTAFAKLAKWHA
ISMKYIKEQPDFLKEFKYGLFEMPTVKTDPFITTGMQSFIEMLDRLPELR
KYKPHFEKIKDKYMQRLQAVMKEYHENRKSDAFYVLCHGDFHLRNMMFKN
NKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINH
YLTVLVATLKSIGYPGELPTQAKLWDEIHKNKYYDFFLLSTFLPLILAIK
SKSFKVNDLIQDPETRQKTYFLDTYVKDVSKLLPKFEQLGYFKCL*

FI01822.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG31300-PA 422 CG31300-PA 1..422 24..445 2226 100 Plus
CG31104-PA 420 CG31104-PA 7..420 32..445 1647 72.2 Plus
CG11893-PA 416 CG11893-PA 1..416 24..445 1587 67.8 Plus
CG13658-PB 422 CG13658-PB 1..422 24..445 1440 62.6 Plus
CG31436-PA 420 CG31436-PA 9..416 32..440 1233 55.7 Plus

FI01822.pep Sequence

Translation from 69 to 1337

> FI01822.pep
MTDKLDAEQFNDDELEAPAWLNRQFIEEILSAYEDSPELKVVDLKITPAS
AQGDHYASVMFRTTAECTTAKGKFSRPLIIKAMPEQDGHKKDMLSESHLF
ETEIGMYCQVLPEFERILRESGDDTKLFVPCIYHSLEPRKVMIFEDLVPQ
GYYVIRDRPVAQEELKTAFAKLAKWHAISMKYIKEQPDFLKEFKYGLFEM
PTVKTDPFITTGMQSFIEMLDRLPELRKYKPHFEKIKDKYMQRLQAVMKE
YHENRKSDAFYVLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPI
TIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQAK
LWDEIHKNKYYDFFLLSTFLPLILAIKSKSFKVNDLIQDPETRQKTYFLD
TYVKDVSKLLPKFEQLGYFKCL*

FI01822.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 19:13:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17564-PA 422 GF17564-PA 1..422 1..422 1772 74.4 Plus
Dana\GF17566-PA 422 GF17566-PA 1..422 1..422 1616 67.8 Plus
Dana\GF17565-PA 419 GF17565-PA 1..419 1..422 1551 65.9 Plus
Dana\GF17567-PA 422 GF17567-PA 1..419 1..419 1414 60.6 Plus
Dana\GF17568-PA 419 GF17568-PA 5..417 6..420 1242 56.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 19:13:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11392-PA 422 GG11392-PA 1..422 1..422 2042 88.4 Plus
Dere\GG11394-PA 416 GG11394-PA 1..416 1..422 1615 68.2 Plus
Dere\GG11393-PA 420 GG11393-PA 7..420 9..422 1520 65.2 Plus
Dere\GG11397-PA 420 GG11397-PA 1..416 1..417 1232 54.7 Plus
Dere\GG11395-PA 417 GG11395-PA 4..414 8..419 1094 50.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 19:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18230-PA 420 GH18230-PA 1..419 1..419 1422 60.1 Plus
Dgri\GH17369-PA 414 GH17369-PA 4..410 6..420 950 45.3 Plus
Dgri\GH14835-PA 412 GH14835-PA 17..411 17..422 389 29.4 Plus
Dgri\GH14824-PA 419 GH14824-PA 10..414 15..417 345 27.8 Plus
Dgri\GH17368-PA 435 GH17368-PA 24..429 11..417 337 25.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG31300-PA 422 CG31300-PA 1..422 1..422 2226 100 Plus
CG31104-PA 420 CG31104-PA 7..420 9..422 1647 72.2 Plus
CG11893-PA 416 CG11893-PA 1..416 1..422 1587 67.8 Plus
CG13658-PB 422 CG13658-PB 1..422 1..422 1440 62.6 Plus
CG31436-PA 420 CG31436-PA 9..416 9..417 1233 55.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 19:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10184-PA 419 GI10184-PA 5..418 2..419 1261 54.1 Plus
Dmoj\GI23912-PA 422 GI23912-PA 4..418 6..419 1210 52.3 Plus
Dmoj\GI10185-PA 370 GI10185-PA 2..369 8..419 1090 50.5 Plus
Dmoj\GI22086-PA 413 GI22086-PA 4..410 6..420 980 44.6 Plus
Dmoj\GI22573-PA 415 GI22573-PA 8..413 10..422 968 44.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 19:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21716-PA 422 GL21716-PA 1..422 1..422 1606 66.8 Plus
Dper\GL21715-PA 421 GL21715-PA 5..421 6..422 1584 69.3 Plus
Dper\GL21718-PA 421 GL21718-PA 5..419 6..420 1332 59.8 Plus
Dper\GL22094-PA 187 GL22094-PA 1..187 1..185 548 55.1 Plus
Dper\GL22107-PA 426 GL22107-PA 19..420 17..417 378 29.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 19:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26378-PA 422 GA26378-PA 1..422 1..422 1613 67.1 Plus
Dpse\GA26377-PA 421 GA26377-PA 5..421 6..422 1590 69.8 Plus
Dpse\GA16250-PA 422 GA16250-PA 1..420 1..420 1333 59.3 Plus
Dpse\GA27377-PA 268 GA27377-PA 1..264 1..265 745 53.2 Plus
Dpse\GA10364-PA 426 GA10364-PA 19..420 17..417 377 29.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 19:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17835-PA 422 GM17835-PA 1..422 1..422 2125 92.9 Plus
Dsec\GM17836-PA 420 GM17836-PA 7..420 9..422 1681 72.9 Plus
Dsec\GM17839-PA 420 GM17839-PA 1..416 1..417 1246 55.4 Plus
Dsec\GM17837-PA 330 GM17837-PA 1..323 83..361 966 56.5 Plus
Dsec\GM17838-PA 437 GM17838-PA 4..437 8..422 951 44 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 19:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21204-PA 422 GD21204-PA 1..422 1..422 2154 94.3 Plus
Dsim\GD21205-PA 420 GD21205-PA 7..420 9..422 1685 72.9 Plus
Dsim\GD21209-PA 416 GD21209-PA 1..416 1..422 1613 68 Plus
Dsim\GD21207-PA 422 GD21207-PA 1..422 1..422 1493 63.5 Plus
Dsim\GD21206-PA 416 GD21206-PA 1..416 1..422 1422 61.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 19:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23474-PA 419 GJ23474-PA 5..419 6..420 1319 56.4 Plus
Dvir\GJ23472-PA 419 GJ23472-PA 7..418 8..419 1317 57.8 Plus
Dvir\GJ23473-PA 422 GJ23473-PA 6..418 6..419 1307 58.2 Plus
Dvir\GJ24004-PA 421 GJ24004-PA 4..420 6..422 1185 51.3 Plus
Dvir\GJ17099-PA 421 GJ17099-PA 7..421 9..420 1054 50.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 19:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12932-PA 423 GK12932-PA 4..423 3..422 1411 61 Plus
Dwil\GK12931-PA 422 GK12931-PA 1..419 1..419 1402 58.2 Plus
Dwil\GK12930-PA 423 GK12930-PA 1..419 1..419 1329 56.6 Plus
Dwil\GK12929-PA 421 GK12929-PA 7..421 8..422 1296 54.2 Plus
Dwil\GK12936-PA 397 GK12936-PA 1..396 1..394 1264 57.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 19:14:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23589-PA 422 GE23589-PA 1..422 1..422 2017 87.9 Plus
Dyak\GE23590-PA 420 GE23590-PA 7..420 9..422 1716 74.9 Plus
Dyak\GE23592-PA 416 GE23592-PA 1..413 1..419 1575 67.3 Plus
Dyak\GE23591-PA 422 GE23591-PA 1..422 1..422 1414 61.8 Plus
Dyak\GE23595-PA 422 GE23595-PA 1..418 1..417 1245 54.9 Plus