Clone FI02004 Report

Search the DGRC for FI02004

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:20
Well:4
Vector:pFlc-1
Associated Gene/TranscriptCG5290-RA
Protein status:FI02004.pep: gold
Sequenced Size:2926

Clone Sequence Records

FI02004.complete Sequence

2926 bp assembled on 2009-08-19

GenBank Submission: BT099638.1

> FI02004.complete
GGGTAACTCCCATCACTAATAAACAATCTGCACGATTTAAAAACATTCTA
GAAACACGCTTTAAATGACTGTTAAGCAATTAAATTAAGATTGAATTAAT
TCAAGAAAAACCGTTAACGTACCAACCAAGTAAAGTTTCTCTTATAAAGT
AGTAACTTTGCCTTAAATCAAGCCGGTATTTTTAAACACGTGAAGCACGT
GGATTGTTTATCCAAAATATACAACAATTTCATCAAAAGCTTTTATAATG
GTTGCCGATATATTCAGTGAATATTATATATGCAATTTCAACGATGCGGT
GACAGTTGAAGATCTGCCCGCGGATGAGACACTGCGTCAATTGTGGACCC
GCCAGAAACTGTGGACAATAGATGAACTCCGGGAGATCCTTCAACGCTGG
CAGGAGCATGTCAAGCCAGATCCGAATGATAATCCCACCTCACAACTCAA
GGATTTCCTGCTGCTGATATTCGCTTTTGTTCAAAACAGTTTTACTGGGC
CCTTTGACAAACTCGAAGAGTACCAACAAATCCATAGTGAACTAGAGCTG
GAGAAACTCGACGCACTCGAGAAACTGAAGGCCAGCGGCGAGGAACTGAA
TCCAAATGTAAAATCTGTAGAACTACTACTGATTGCCAGGGAAATCCTTG
AGGGACTTTTAGAAAACCATCCAGAATCAAAGGTCCTGATTTGGTGGCGA
TTGCGTCTGATCTGCCTGCATCAACATGTGCTGGATGATTTGGCGGCCTC
CCTGTATGAGCAGTTTAAGTCAGCAGCTGGACATCTTCAGGCTCATTTCA
ATCAGTTTGAGAGCAGGGAACTGCAATCCCTGCTACTACTGGAGTTGGCC
AATGGCTACCTGCAGTTTCATCGCTCTGAAATAGCCTCCCAAATACTGGA
TGAACTGTGCAAGCATCTCCAGGTGGAGCTAAAAGTTGAGGGTTTACTAG
GAGTACGCACCAAATTCCAGCAGAAGGCCCTGCCACAACTCTGCCTCAAA
GTTGAGCATCTAAACGAGCAGCAGCCTCTGCCTCCAGCCGTCCAAACAAA
TGAGACGACCAAATTGCCAAAACTGCTTCTTCTGGAGGATGACACGCGAC
TGGAGCGGATACGCTTTGTGGAACTGAAGGACAACGAAGTGATGACGCTT
CCCAGTGTTCTCCAAGCTCTGGTGCTGGCCAAAGTAAAGCAATTGAAACG
CTCAACGCCTAAGGATCGCCTGGCGGATGAACAACTGGAGCCGTATACAC
AAACCCTACTTTACCAGGAACACGGACCATTCCAAGTCCGGCAGTCAGCC
CTTCTTCTAAACTGCCTTCAGGAATCGAATCAAAGAAGGACAGTCGAACG
CAGCTGGAAACAATGCGAGGAGTGTGTCAAACTGCTTGACACCTCCGAGG
AGGAGCTATCGCTGCGATCCCGACTCTCCTACGGTTTCGCCGCCCACTTG
AGTCCCAAGTGGCAGGTGCAGCTACAGCTTGTCGACTTGCTGCGATCCTT
GGGCATGACCAAAACAGCTCTGGACATCTGTCTTCGCATACACGCCTGGC
AGCAGGTGATCGAGTGCTACACGAGTCTGGAACTCCGTCACAAGGCAGCG
GAGATCATCAGGCAGGAACTGGAGAAGAAGCCAACGGCATTGCTGTACTG
CCTCCTTGGCGATGCTATCGATGATCCTTCGTTCTATGAGCAGGCTTGGT
TGTATTCCAAAAAGACAAGTGGAAAAGCTCAAGCCTATTGGGGCAACCAT
TTCTATAGGAGTGCGGATTATGCCCAGGCAATGGATCACTTCGAGATTTC
GCTAGAGATTAACAACTTGCAGGAAGCGATTCTTTTGCGCTGTGGCTACT
GTGCAATCCAACTGGAACGCTGGGAGCCGGCTGTTAAATATTATTTGGCT
TACACCCACCTGGAACCCAATGGATTCGAATCCTGGAATAACCTAGCCAA
GGCCCTGATTAAATTGGGTGACAAACAGCGGGCCCATCGTGTTCTTGGTG
AGGCCTTGAAGTGCAACTACAGCAACTGGAAGGTTTGGGAGAACTACATG
CTGGTGTCCGTGGATACTTCCCACTGGGACGACGCCATGCGGGCTTACCA
GCGCATGGCGGAGCTAAAGCAGCACTACCTCGATCAGGAAGTGCTAACCC
GTATTGTTTACGGAGTTTCCAAGGAGGACCCCGCCGGCTCAAGTGCTCTG
ATCAAAAGACTCATAAAGCTTCTGGGACAGCAGAGCATTCAACATGGTAA
CGAGCCTCTTGTGTGGGAACTGGCCGCCTTGGTGGCCCAAACGCCACTGA
AGAAGGCCGAGAAACTGGTAAAATCGTATCGTGCGTACACACCGAAGCAT
TTGGGCTGGGAAACCAAGTCGGAGCACGCTTTAAAAGCCCTAGATCTTTG
TTTAGAGGTCTGCGATCTCTCAGTGGCGGCCATCACAGAGCACATTCAAG
AGGAAAGTGAGGTAATGATTACCTCTCAACTAAATTCAGCCAGACTGGCG
GGAACATCTTGTCTGAATGCTTTGAAGAGAGCCATAAATGTGGATGTATC
GGCAGAACAGACTGCAAAAGTGGAGCAGCTGGAAAAACGCATCGAAGACC
TGACAAAAATTGTCCAGGAACGAATGAATGCGTCTCGATCTTAGTTATAC
ACTATATAAGGTTTTATACTATTTTGTAATTGCAAAACAAATAAAAAGAG
TCATTTTTTATTGTACATGAAATAGTTTATTGCTGATATATATTTGTAAG
CTAGTTTTGATTTGTAATATAATTCAGCTCAAGCAGATTATCCAGTTTTT
CTGATTTTAAAAGCTATTGCGCATTAAGGATTTATTGTCTAGCAATAGGT
GCAATGAAAGTGTATTCATAAAAATATAAACCTATGAATTAACCCATCAT
CCAATATCACAAAAAAAAAAAAAAAA

FI02004.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG5290-RA 2913 CG5290-RA 4..2911 5..2912 14540 100 Plus
CG14353.a 1501 CG14353.a 1302..1501 2912..2713 1000 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17899100..17900824 2910..1186 8625 100 Minus
chr3L 24539361 chr3L 17900886..17901390 1185..681 2525 100 Minus
chr3L 24539361 chr3L 17901441..17901815 684..310 1875 100 Minus
chr3L 24539361 chr3L 17901865..17902171 311..5 1535 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG5290-RA 2397 CG5290-PA 1..2397 248..2644 11985 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:07:07 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG5290-RA 2917 CG5290-RA 12..2917 5..2910 14530 100 Plus
CG14353-RA 1485 CG14353-RA 1285..1485 2910..2710 1005 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG5290-PA 798 CG5290-PA 1..798 248..2641 3791 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17909481..17911207 2912..1186 8635 100 Minus
3L 28110227 3L 17911269..17911773 1185..681 2525 100 Minus
3L 28110227 3L 17911824..17912198 684..310 1875 100 Minus
3L 28110227 3L 17912248..17912554 311..5 1535 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17902581..17904307 2912..1186 8635 100 Minus
3L 28103327 3L 17904369..17904873 1185..681 2525 100 Minus
3L 28103327 3L 17904924..17905298 684..310 1875 100 Minus
3L 28103327 3L 17905348..17905654 311..5 1535 100 Minus
Blast to na_te.dros performed 2014-11-26 19:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
TAHRE 10463 TAHRE OSV 10463bp 5231..5267 249..213 122 81.1 Minus

FI02004.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:32:56 Download gff for FI02004.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17901865..17902174 1..311 99   Minus
chr3L 17901443..17901813 312..682 100 <- Minus
chr3L 17900886..17901388 683..1185 100 <- Minus
chr3L 17899100..17900824 1186..2910 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:14:40 Download gff for FI02004.complete
Subject Subject Range Query Range Percent Splice Strand
CG5290-RA 1..2397 248..2644 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:51:23 Download gff for FI02004.complete
Subject Subject Range Query Range Percent Splice Strand
CG5290-RA 1..2397 248..2644 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:31:19 Download gff for FI02004.complete
Subject Subject Range Query Range Percent Splice Strand
CG5290-RA 1..2397 248..2644 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:32:56 Download gff for FI02004.complete
Subject Subject Range Query Range Percent Splice Strand
CG5290-RA 1..2397 248..2644 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-19 16:18:38 Download gff for FI02004.complete
Subject Subject Range Query Range Percent Splice Strand
CG5290-RA 1..2909 2..2910 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:51:23 Download gff for FI02004.complete
Subject Subject Range Query Range Percent Splice Strand
CG5290-RA 1..2909 2..2910 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:31:19 Download gff for FI02004.complete
Subject Subject Range Query Range Percent Splice Strand
CG5290-RA 9..2917 1..2910 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:32:56 Download gff for FI02004.complete
Subject Subject Range Query Range Percent Splice Strand
CG5290-RA 9..2917 1..2910 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:32:56 Download gff for FI02004.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17912248..17912557 1..311 99   Minus
3L 17911826..17912196 312..682 100 <- Minus
3L 17911269..17911771 683..1185 100 <- Minus
3L 17909483..17911207 1186..2910 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:31:19 Download gff for FI02004.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17905348..17905657 1..311 99   Minus
arm_3L 17904926..17905296 312..682 100 <- Minus
arm_3L 17904369..17904871 683..1185 100 <- Minus
arm_3L 17902583..17904307 1186..2910 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:27:27 Download gff for FI02004.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17905348..17905657 1..311 99   Minus
3L 17904926..17905296 312..682 100 <- Minus
3L 17904369..17904871 683..1185 100 <- Minus
3L 17902583..17904307 1186..2910 100 <- Minus

FI02004.pep Sequence

Translation from 247 to 2643

> FI02004.pep
MVADIFSEYYICNFNDAVTVEDLPADETLRQLWTRQKLWTIDELREILQR
WQEHVKPDPNDNPTSQLKDFLLLIFAFVQNSFTGPFDKLEEYQQIHSELE
LEKLDALEKLKASGEELNPNVKSVELLLIAREILEGLLENHPESKVLIWW
RLRLICLHQHVLDDLAASLYEQFKSAAGHLQAHFNQFESRELQSLLLLEL
ANGYLQFHRSEIASQILDELCKHLQVELKVEGLLGVRTKFQQKALPQLCL
KVEHLNEQQPLPPAVQTNETTKLPKLLLLEDDTRLERIRFVELKDNEVMT
LPSVLQALVLAKVKQLKRSTPKDRLADEQLEPYTQTLLYQEHGPFQVRQS
ALLLNCLQESNQRRTVERSWKQCEECVKLLDTSEEELSLRSRLSYGFAAH
LSPKWQVQLQLVDLLRSLGMTKTALDICLRIHAWQQVIECYTSLELRHKA
AEIIRQELEKKPTALLYCLLGDAIDDPSFYEQAWLYSKKTSGKAQAYWGN
HFYRSADYAQAMDHFEISLEINNLQEAILLRCGYCAIQLERWEPAVKYYL
AYTHLEPNGFESWNNLAKALIKLGDKQRAHRVLGEALKCNYSNWKVWENY
MLVSVDTSHWDDAMRAYQRMAELKQHYLDQEVLTRIVYGVSKEDPAGSSA
LIKRLIKLLGQQSIQHGNEPLVWELAALVAQTPLKKAEKLVKSYRAYTPK
HLGWETKSEHALKALDLCLEVCDLSVAAITEHIQEESEVMITSQLNSARL
AGTSCLNALKRAINVDVSAEQTAKVEQLEKRIEDLTKIVQERMNASRS*

FI02004.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:00:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25224-PA 797 GF25224-PA 1..797 1..798 3436 83.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15767-PA 798 GG15767-PA 1..798 1..798 4013 96.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14446-PA 808 GH14446-PA 1..805 1..793 2960 71.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:00:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG5290-PA 798 CG5290-PA 1..798 1..798 4122 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13581-PA 805 GI13581-PA 1..801 1..794 2962 70.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22733-PA 805 GL22733-PA 5..804 4..798 3153 76.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18790-PA 803 GA18790-PA 5..802 4..798 3145 76.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11644-PA 798 GM11644-PA 1..798 1..798 4007 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12360-PA 798 GD12360-PA 1..798 1..798 4021 97.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13919-PA 803 GJ13919-PA 1..800 1..793 3059 73.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20574-PA 799 GK20574-PA 1..796 1..793 3064 75.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22100-PA 773 GE22100-PA 1..773 1..798 3872 93.5 Plus

FI02004.hyp Sequence

Translation from 247 to 2643

> FI02004.hyp
MVADIFSEYYICNFNDAVTVEDLPADETLRQLWTRQKLWTIDELREILQR
WQEHVKPDPNDNPTSQLKDFLLLIFAFVQNSFTGPFDKLEEYQQIHSELE
LEKLDALEKLKASGEELNPNVKSVELLLIAREILEGLLENHPESKVLIWW
RLRLICLHQHVLDDLAASLYEQFKSAAGHLQAHFNQFESRELQSLLLLEL
ANGYLQFHRSEIASQILDELCKHLQVELKVEGLLGVRTKFQQKALPQLCL
KVEHLNEQQPLPPAVQTNETTKLPKLLLLEDDTRLERIRFVELKDNEVMT
LPSVLQALVLAKVKQLKRSTPKDRLADEQLEPYTQTLLYQEHGPFQVRQS
ALLLNCLQESNQRRTVERSWKQCEECVKLLDTSEEELSLRSRLSYGFAAH
LSPKWQVQLQLVDLLRSLGMTKTALDICLRIHAWQQVIECYTSLELRHKA
AEIIRQELEKKPTALLYCLLGDAIDDPSFYEQAWLYSKKTSGKAQAYWGN
HFYRSADYAQAMDHFEISLEINNLQEAILLRCGYCAIQLERWEPAVKYYL
AYTHLEPNGFESWNNLAKALIKLGDKQRAHRVLGEALKCNYSNWKVWENY
MLVSVDTSHWDDAMRAYQRMAELKQHYLDQEVLTRIVYGVSKEDPAGSSA
LIKRLIKLLGQQSIQHGNEPLVWELAALVAQTPLKKAEKLVKSYRAYTPK
HLGWETKSEHALKALDLCLEVCDLSVAAITEHIQEESEVMITSQLNSARL
AGTSCLNALKRAINVDVSAEQTAKVEQLEKRIEDLTKIVQERMNASRS*

FI02004.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG5290-PA 798 CG5290-PA 1..798 1..798 4122 100 Plus