Clone FI02011 Report

Search the DGRC for FI02011

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:20
Well:11
Vector:pFlc-1
Associated Gene/TranscriptCG7800-RA
Protein status:FI02011.pep: gold
Sequenced Size:1773

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7800 2008-12-18 5.12 accounting

Clone Sequence Records

FI02011.complete Sequence

1773 bp assembled on 2008-10-27

GenBank Submission: BT050427.1

> FI02011.complete
AGGTACTACCTATATATCAACAGATTGTAAACGCGGTTAGGTTTCAAAAG
TTATAGTAGTTGTAGTTGTTATGAAAAGCAACTATGTACCTAATAATCAT
CGCCCTGCTTGCAAGTGTATCCGCTTTAGGCCGCCCAGACTTGGAGGACT
ACTGCAATGATTCCTATTGCCATTTACTTGGTCGGAGCCGGACGTTTAGC
GATAAGAAGGCTACCAAACTAACCGAGTTCCACATGGACTCCTGCGAAAA
GAAGGTACTCAAACTTATGCCCAATCTGCGCACCCTGGAGCTGGAGAACT
GCGACAGTCCGGACTTCACCATGAACGACCTGAATCAACTGCCGTACCTA
ACAAGCCTTCAATTGCGACGTGGAAATCTTTTGGGGCTGCACGACGAGCA
CTTCTCGAAGTGGCCAAACATGAAGATCCTTATGCTGGGGGGGAACAACA
TAACGAGACTATCCAATGAATGCTTTAAAGGCCTAGCTCAGCTCTGGCTG
CTGTCTCTGCCGGGGAATGGTATTCAAGGTTTGCCATGGGATGTATTTCA
AAACCTACCAGAACTTCTGCATCTCGACCTAAGTGGCAATAGAATCGAAA
CTCTTCACGAAAACATTTTTACAGGCGTTCCCAAGCTAGAGATGCTGCTA
CTCAATGGGAATCCCTTGACATGGATAGCGCCTACGTCTCTAAAATCTCT
AAGTAACCTACGCCTTTTGGACATGAGCAACTGTGGACCGCTGCCGGATC
TTTCATTGCCCGGTGCACATACCTTGATCCTCGACAACAGCGGTGTGCAG
CGCCTGGACATTTTGGGCAGTGTCCATAAACTCCAGGCGAGGAAAAACCA
TATAACCGAGATTAAATTACCCGACAAAAGCTCTGTTATCGAACTGGATT
TGCATAGCAATTTACTGACCGCTACCGATATTCCCAAACTTCTAACGGGC
ATGTGGCGACTGCAACGACTGGATCTATCCGAGAATATCATAGGGATATA
CGCAGCCGCCGGAAGCGACAATACGAGCGAGCTCTTCATACTTCCCAATC
TTATGTATATGAACCTATCGGCAAATCGCCTGACGCGTCTGCACTTCGAT
TCGCCAATTCCATGGGAAAGGCTTACTCATTTGGACGCTTCGTACAATAG
AATATATGCTCCCGCAAAGGTTGGCATTGACGAAGCTTTCAATCTTCAAA
GTTTGCATTTGGAGGGAAATTATATTAACAATTTTGAACTTACACCCTGG
AAACCTCATCCAAGTCTGAAAGAGGTTGCTCTGTACGATAATAAATTCCA
GCCTAAGGGCTATAAAAATATTACAAAGTTCTTCAATGAAATTGGAGTAA
ACGTCTTAGAGAAAACGCAATACAGTCAATCAAACAACACGACTCCAACT
TGTAAGCCGTGCATACCAGATGCCAGAGATTTTCCTACGAGTATAAGCGC
CGACACAAACCAAACCATAGATACCAAAGTTAATCCTTTAAGCAACGACA
CTTATCAATGGAATGTATGGAACGTACTGATGCTAGTTTCCCTGATTGTT
TCCTTGTTCGTAAACTCTTTTCTAATCGTGAAACTCATTCGTTTGAGAGG
AAGAAACCAGTTCACGCAATCATCATCGGTACCTGCCATAATCGAAATGT
TTTCAAACGAATCTGATGATGAAATTATCCTGTAATATAATCATTCTACT
TAACATGTATATATTTAAACTTTTCCTTAAATAATAATAAAGAATCTCTT
GAGTTTTAAAAAAAAAAAAAAAA

FI02011.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG7800-RA 1768 CG7800-RA 1..1757 1..1757 8770 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4043977..4045733 1..1757 8740 99.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG7800-RA 1602 CG7800-PA 1..1602 84..1685 7995 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:07:08 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG7800-RA 1778 CG7800-RA 22..1778 1..1757 8770 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG7800-PA 533 CG7800-PA 1..533 84..1682 2793 100 Plus
CG18249-PB 559 CG18249-PB 14..559 90..1673 698 35.4 Plus
CG18249-PC 555 CG18249-PC 14..507 90..1562 697 36.3 Plus
18w-PA 1385 CG8896-PA 216..538 312..1232 249 28.7 Plus
Toll-7-PA 1446 CG8595-PA 268..573 330..1226 230 29.6 Plus
18w-PA 1385 CG8896-PA 259..650 198..1292 199 25.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:40:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8217978..8219734 1..1757 8770 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7958809..7960565 1..1757 8770 99.9 Plus
Blast to na_te.dros performed 2014-11-27 11:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 2733..2872 1362..1496 121 56.4 Plus

FI02011.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:30:10 Download gff for FI02011.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4043977..4045733 1..1757 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:59 Download gff for FI02011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7800-RA 1..1602 84..1685 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:17:32 Download gff for FI02011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7800-RA 1..1602 84..1685 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:45:15 Download gff for FI02011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7800-RA 1..1602 84..1685 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:30:10 Download gff for FI02011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7800-RA 1..1602 84..1685 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:57:32 Download gff for FI02011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7800-RA 1..1757 1..1757 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:17:31 Download gff for FI02011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7800-RA 1..1757 1..1757 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:15 Download gff for FI02011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7800-RA 22..1778 1..1757 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-27 17:50:07 Download gff for FI02011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7800-RA 1..1757 1..1757 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:30:10 Download gff for FI02011.complete
Subject Subject Range Query Range Percent Splice Strand
CG7800-RA 22..1778 1..1757 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:30:10 Download gff for FI02011.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8217978..8219734 1..1757 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:15 Download gff for FI02011.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4043700..4045456 1..1757 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:48:38 Download gff for FI02011.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7958809..7960565 1..1757 99   Plus

FI02011.pep Sequence

Translation from 83 to 1684

> FI02011.pep
MYLIIIALLASVSALGRPDLEDYCNDSYCHLLGRSRTFSDKKATKLTEFH
MDSCEKKVLKLMPNLRTLELENCDSPDFTMNDLNQLPYLTSLQLRRGNLL
GLHDEHFSKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGL
PWDVFQNLPELLHLDLSGNRIETLHENIFTGVPKLEMLLLNGNPLTWIAP
TSLKSLSNLRLLDMSNCGPLPDLSLPGAHTLILDNSGVQRLDILGSVHKL
QARKNHITEIKLPDKSSVIELDLHSNLLTATDIPKLLTGMWRLQRLDLSE
NIIGIYAAAGSDNTSELFILPNLMYMNLSANRLTRLHFDSPIPWERLTHL
DASYNRIYAPAKVGIDEAFNLQSLHLEGNYINNFELTPWKPHPSLKEVAL
YDNKFQPKGYKNITKFFNEIGVNVLEKTQYSQSNNTTPTCKPCIPDARDF
PTSISADTNQTIDTKVNPLSNDTYQWNVWNVLMLVSLIVSLFVNSFLIVK
LIRLRGRNQFTQSSSVPAIIEMFSNESDDEIIL*

FI02011.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 22:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18847-PA 547 GF18847-PA 16..449 5..429 671 39.7 Plus
Dana\GF11743-PA 1384 GF11743-PA 210..533 77..384 223 29.4 Plus
Dana\GF18811-PA 1407 GF18811-PA 174..555 51..400 213 28.3 Plus
Dana\GF10307-PA 575 GF10307-PA 46..433 25..405 204 24.8 Plus
Dana\GF11739-PA 1455 GF11739-PA 281..589 83..384 199 29.3 Plus
Dana\GF11743-PA 1384 GF11743-PA 252..644 38..403 167 25.7 Plus
Dana\GF18811-PA 1407 GF18811-PA 289..656 46..405 155 24.5 Plus
Dana\GF18811-PA 1407 GF18811-PA 430..680 89..405 154 25.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 22:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23482-PA 531 GG23482-PA 1..531 1..533 2156 77.5 Plus
Dere\GG23591-PA 556 GG23591-PA 20..460 8..436 661 39.7 Plus
Dere\GG14011-PA 552 GG14011-PA 108..461 23..414 220 26.4 Plus
Dere\GG22011-PA 1390 GG22011-PA 216..539 77..384 217 28.3 Plus
Dere\GG22003-PA 1449 GG22003-PA 268..573 83..381 197 29.6 Plus
Dere\GG22011-PA 1390 GG22011-PA 270..650 50..403 172 26.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 22:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18328-PA 553 GH18328-PA 53..511 34..501 530 35.8 Plus
Dgri\GH23027-PA 1419 GH23027-PA 223..546 77..384 218 28.6 Plus
Dgri\GH23021-PA 1486 GH23021-PA 278..586 83..384 202 28.7 Plus
Dgri\GH19410-PA 576 GH19410-PA 119..445 64..354 195 25.9 Plus
Dgri\GH17015-PA 1548 GH17015-PA 210..586 89..406 190 27.6 Plus
Dgri\GH23027-PA 1419 GH23027-PA 265..657 38..403 164 25.9 Plus
Dgri\GH23021-PA 1486 GH23021-PA 309..697 42..403 159 24.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG7800-PA 533 CG7800-PA 1..533 1..533 2793 100 Plus
CG18249-PB 559 CG18249-PB 14..559 3..530 698 35.4 Plus
CG18249-PC 555 CG18249-PC 14..507 3..493 697 36.3 Plus
18w-PA 1385 CG8896-PA 216..538 77..383 249 28.7 Plus
CG6749-PA 552 CG6749-PA 110..451 25..404 232 26.8 Plus
18w-PA 1385 CG8896-PA 259..650 39..403 199 25.5 Plus
18w-PA 1385 CG8896-PA 58..440 9..404 162 24.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 22:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23308-PA 550 GI23308-PA 27..513 17..504 542 33.3 Plus
Dmoj\GI22613-PA 582 GI22613-PA 121..445 65..350 213 26.9 Plus
Dmoj\GI11909-PA 1550 GI11909-PA 393..776 50..405 207 26.9 Plus
Dmoj\GI21098-PA 1417 GI21098-PA 220..543 77..384 202 28 Plus
Dmoj\GI21088-PA 1445 GI21088-PA 279..587 83..384 201 28.7 Plus
Dmoj\GI11909-PA 1550 GI11909-PA 547..828 85..385 171 27.8 Plus
Dmoj\GI11909-PA 1550 GI11909-PA 226..586 57..406 165 25.6 Plus
Dmoj\GI21098-PA 1417 GI21098-PA 262..654 38..403 160 25.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 22:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24259-PA 545 GL24259-PA 27..457 14..437 679 42.6 Plus
Dper\GL10362-PA 1425 GL10362-PA 272..580 83..384 201 29 Plus
Dper\GL18021-PA 578 GL18021-PA 53..441 24..405 197 24.8 Plus
Dper\GL24790-PA 1360 GL24790-PA 230..565 83..432 184 26.3 Plus
Dper\GL14012-PA 1409 GL14012-PA 177..554 55..400 183 27.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 22:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14853-PA 545 GA14853-PA 29..467 16..441 680 42.3 Plus
Dpse\GA21398-PA 1387 GA21398-PA 209..532 77..384 211 28.8 Plus
Dpse\GA21191-PA 1445 GA21191-PA 272..580 83..384 199 29 Plus
Dpse\GA18548-PA 578 GA18548-PA 53..441 24..405 197 24.8 Plus
Dpse\GA19932-PA 1350 GA19932-PA 230..565 83..432 184 26.3 Plus
Dpse\GA21398-PA 1387 GA21398-PA 263..643 50..403 171 26.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 22:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23706-PA 555 GM23706-PA 14..452 3..429 598 38.7 Plus
Dsec\GM21990-PA 1387 GM21990-PA 216..539 77..384 216 28.3 Plus
Dsec\GM23705-PA 256 GM23705-PA 211..252 45..86 207 90.5 Plus
Dsec\GM24845-PA 552 GM24845-PA 110..452 25..405 198 26.8 Plus
Dsec\GM21984-PA 1444 GM21984-PA 268..573 83..381 194 29.3 Plus
Dsec\GM21990-PA 1387 GM21990-PA 270..650 50..403 163 26 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 22:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18519-PA 531 GD18519-PA 1..531 1..533 2323 84.7 Plus
Dsim\GD18520-PA 555 GD18520-PA 14..452 3..429 636 39 Plus
Dsim\GD12897-PA 552 GD12897-PA 110..452 25..405 207 26.8 Plus
Dsim\GD12499-PA 574 GD12499-PA 93..431 86..405 200 26.4 Plus
Dsim\GD21488-PA 962 GD21488-PA 172..553 51..400 197 27 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 22:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24164-PA 545 GJ24164-PA 77..508 57..504 556 35.2 Plus
Dvir\GJ23859-PA 571 GJ23859-PA 111..369 65..301 225 29.4 Plus
Dvir\GJ20945-PA 1417 GJ20945-PA 219..542 77..384 205 28.3 Plus
Dvir\GJ20935-PA 1443 GJ20935-PA 270..578 83..384 202 28.7 Plus
Dvir\GJ13849-PA 1365 GJ13849-PA 229..534 83..381 190 27.2 Plus
Dvir\GJ20935-PA 1443 GJ20935-PA 301..689 42..403 160 24.5 Plus
Dvir\GJ20945-PA 1417 GJ20945-PA 261..653 38..403 159 25.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 22:00:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14381-PA 559 GK14381-PA 25..462 11..436 669 40.1 Plus
Dwil\GK15901-PA 1400 GK15901-PA 220..543 77..384 218 28.3 Plus
Dwil\GK13202-PA 1397 GK13202-PA 176..553 55..400 203 28.2 Plus
Dwil\GK15893-PA 1441 GK15893-PA 267..575 83..384 202 29 Plus
Dwil\GK12340-PA 1553 GK12340-PA 224..516 102..357 187 30.3 Plus
Dwil\GK15901-PA 1400 GK15901-PA 262..654 38..403 172 25.9 Plus
Dwil\GK15893-PA 1441 GK15893-PA 294..686 38..403 165 24.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 22:00:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25852-PA 472 GE25852-PA 1..472 1..532 1793 67.7 Plus
Dyak\GE25853-PA 555 GE25853-PA 25..500 14..486 645 37 Plus
Dyak\18w-PA 1388 GE12089-PA 217..540 77..384 218 28.3 Plus
Dyak\GE20306-PA 552 GE20306-PA 110..452 25..405 206 26.2 Plus
Dyak\GE12083-PA 1438 GE12083-PA 268..573 83..381 198 29.6 Plus
Dyak\18w-PA 1388 GE12089-PA 271..651 50..403 174 26.2 Plus

FI02011.hyp Sequence

Translation from 83 to 1684

> FI02011.hyp
MYLIIIALLASVSALGRPDLEDYCNDSYCHLLGRSRTFSDKKATKLTEFH
MDSCEKKVLKLMPNLRTLELENCDSPDFTMNDLNQLPYLTSLQLRRGNLL
GLHDEHFSKWPNMKILMLGGNNITRLSNECFKGLAQLWLLSLPGNGIQGL
PWDVFQNLPELLHLDLSGNRIETLHENIFTGVPKLEMLLLNGNPLTWIAP
TSLKSLSNLRLLDMSNCGPLPDLSLPGAHTLILDNSGVQRLDILGSVHKL
QARKNHITEIKLPDKSSVIELDLHSNLLTATDIPKLLTGMWRLQRLDLSE
NIIGIYAAAGSDNTSELFILPNLMYMNLSANRLTRLHFDSPIPWERLTHL
DASYNRIYAPAKVGIDEAFNLQSLHLEGNYINNFELTPWKPHPSLKEVAL
YDNKFQPKGYKNITKFFNEIGVNVLEKTQYSQSNNTTPTCKPCIPDARDF
PTSISADTNQTIDTKVNPLSNDTYQWNVWNVLMLVSLIVSLFVNSFLIVK
LIRLRGRNQFTQSSSVPAIIEMFSNESDDEIIL*

FI02011.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG7800-PA 533 CG7800-PA 1..533 1..533 2793 100 Plus
CG18249-PB 559 CG18249-PB 14..559 3..530 698 35.4 Plus
CG18249-PC 555 CG18249-PC 14..507 3..493 697 36.3 Plus
18w-PA 1385 CG8896-PA 216..538 77..383 249 28.7 Plus
CG6749-PA 552 CG6749-PA 110..451 25..404 232 26.8 Plus
18w-PA 1385 CG8896-PA 259..650 39..403 199 25.5 Plus
18w-PA 1385 CG8896-PA 58..440 9..404 162 24.6 Plus