Clone FI02019 Report

Search the DGRC for FI02019

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:20
Well:19
Vector:pFlc-1
Associated Gene/TranscriptCG9518-RA
Protein status:FI02019.pep: gold
Sequenced Size:3689

Clone Sequence Records

FI02019.complete Sequence

3689 bp assembled on 2009-01-14

GenBank Submission: BT057975.1

> FI02019.complete
GGTTGACTACGTGCAACGCAGCCGCGCAGACGCAGTCAGCGGTTTGAAAA
TCCGACCTAAATAATCCATATATGCATACATATATGTACATATTTCTCAA
ACATCATCAAATTCAACCAATCCAAAGGATCCCGTGATTTGTGATCGATG
TGCCAATAGTGCCAGGCAACGTGGGCTAAGAATCGCAATTGGCCTACGAC
GAGCACAAGGATAGCACAACAAGGATAAGGAAATACTAGTTAAGGAATCA
AATAACGCACACACATTTGATAGAAATTTAGTACTTTAAAGACAAGGAAG
CAAAGGATTCTCTGCAATGGTGTTGTGAACAAGTCAAAAAGACGGAATTC
TTGTTCAAAGAAGCACACACTTAATGGTTAACAAGCTATAAAGAACGTAT
ATAGAAAATCGGGAAAGCAAAAAAACATAGTGACACAAAAGCACTGGAGC
AAAGCAACATTGAAACTGAGCAGATTACTAAAAATTTGGGCCATATCAGA
GCCCCGCCATGCACAAAAGAAAGAAACCCTAGACTTTAGAGAGTGTAAAG
AAGCAGATAGCAACTGCTATCAACACTAAACCAAGAAAAGTGTGGTAATA
TAGCTAAAACTGGCTTAAACTTGGGATAATCCCACAGAGAACTCAAATAG
ACATCCATCTGGCAACATGGTGCTCAATCTGCTGTTCATAACCACTGTGA
TCAAGTCCACATTTGGCGTGGTGACCACGGGACTCTGGCTAATTCCACTG
ATGCTGGCCGCCATCACATACTATCGCTATGATGCCGTAGATCCCGAGTC
GAGGCCGCTAGATCAACTGAATTTGTATCCAGAGTACGATTTTATAGTGG
TGGGCAGTGGTTCGGCCGGAGCTGTGGTGGCCAATCGTTTGAGCGAGGTG
AGGAAATGGAAAGTACTGCTGATCGAAGCCGGTCCAGATGAAAACGAGAT
CTCTGATGTACCATCGCTGGCGGCCTATTTGCAATTGAGCAAACTGGATT
GGGCCTACAAGACGGAACCCTCGACGAAGGCGTGTTTGGGAATGCAGAAC
AATCGTTGCAATTGGCCAAGAGGACGAGTCTTGGGCGGCAGTTCGGTGCT
CAACTATATGCTCTATGTGCGTGGCAATCGCCATGATTACGATCACTGGG
CATCGTTGGGCAATCCAGGCTGGGATTACGACAATGTGTTGCGTTATTTT
AAGAAATCGGAGGATAATCGTAATCCCTATTTGGCCAACAACAAGTATCA
TGGTCGCGGAGGACTGCTAACGGTTCAGGAATCACCGTGGCATTCACCTT
TGGTTGCCGCCTTTGTGGAAGCCGGTACTCAGTTGGGCTATGATAATCGT
GACATTAATGGCGCCAAACAGGCGGGCTTTATGATTGCCCAAGGAACGAT
ACGTCGTGGTTCGAGATGTTCCACCGCCAAGGCATTTCTGCGACCCATAC
GCATGCGAAAGAATTTCCATCTGTCGATGAACTCACATGTGACCAGGGTC
ATCATTGAACCGGGAACGATGAGGGCACAGGCCGTGGAATTTGTGAAACA
TGGCAAAGTGTATAGGATAGCGGCCAGGAGGGAGGTTATCATCTCAGCTG
GTGCCATCAATACCCCGCAGCTAATGATGCTCTCTGGTTTGGGACCACGA
AAACATCTGGAAAAGCATGGCATTCGAGTGTTGCAAGATCTGCCCGTTGG
CGAGAATATGCAGGATCATGTGGGAATGGGTGGACTCACTTTTCTGGTCG
ATAAGCCCGTGGCCATTGTCCAGGATCGTTTCAATCCCACAGCCGTCACC
TTTCAGTATGTGTTGCGTGAACGAGGACCGATGACCACATTGGGTGGAGT
CGAGGGTCTGGCCTTTGTGCACACACCCTACTCAAATCGCAGTCTCGATT
GGCCGGATATTCAATTTCATATGGCACCGGCTTCCATTAACTCAGATAAT
GGAGCCAGAGTAAAGAAGGTGTTGGGCCTGAAGGAATCGGTGTACCAAGA
GGTCTATCATCCCATAGCCAACAAGGATAGTTGGACGATAATGCCGCTGC
TATTGAGGCCAAGATCGCGGGGATCTGTTAAATTACGATCGGCGAATCCC
TTTCACTATCCCCTAATCAATGCCAACTACTTTGACGATCCCTTGGATGC
CAAAACTTTGGTGGAAGGAGCCAAGATAGCTCTTCGCGTAGCTGAAGCCC
AGGTTTTCAAGCAATTCGGATCGAGACTGTGGCGTAAACCGCTGCCCAAT
TGCAAACAGCATAAATTCCTATCCGATGCCTATTTGGAGTGCCATGTGCG
CACCATTTCGATGACCATCTACCATCCATGTGGCACTGCGAAGATGGGAC
CCGCCTGGGATCCCGAGGCTGTGGTGGATCCACGCTTGAGGGTCTATGGA
GTTCGCGGTCTCAGGGTGATTGATGCCAGCATTATGCCAACGATTAGTAG
TGGGAATACCAATGCACCGGTTATAATGATAGCTGAAAAGGGCGCAGATC
TCATCAAGGAAGATTGGCTAACAAATCCCGAGTACAAAGTAAAGCGGCAG
GCAAATAGACTTAGAGATCCAGATCCTGCTAGTAGTAACATTCAGGGCAT
CATCACATTGCCCAACAATATCACTCAAGGCGACAGCAGCAACATCAGTG
ACAGGAGCAACATGGAGAGCAACTTCAGCAACAGCAGTCACATAAACAAC
ATCAATTTTAACAGCAACAGCAACAGCAGCAACATTGAAAGCAGCAGCAA
CTTCACACTCAACTATGCGAATAGTTAGTGACTTCAAAATGAAGAATGTA
GAGCTCCAGTTAGCTCGAGATTTTGTGCTCAGGGCTCCATAGCTTTAAAC
ACTCACATAAAGTGTTTACAACGAGAAAACAACACAAATTGTTTGCCATT
GCTAAAGTAACATGCTGAGACATAAACTGTTTGAGTTCGTTAATAACTCA
AGTGAAACCAGAATGTGATCCAAAAAATTCACCGAACATTCTTTACCTAA
AGTCTACACTGAAACCAGAAGCTATCTTATTTATGAAAATAACCATAATC
AAACATATTATCACCGACTTGAAAGCGTCTTGAACAAAAGTTATTTACTA
CTGTAGTTCATTATCATTCGATGGCCATCTTGTAATGCTCATAAAAAGCT
TTACTGCGAAACCAGAAGTTCTTAGCAGCTAAAACTGGTTGCTTCTTCCT
TGTGAAGCCATTTAAAAATGCGACTCATAAAAGGTTTATATCTGAGAATC
ATACTATTATGTCGTCTGTCTTTGATCTAGACAATTGGTACTCCAAAAAA
GTTATTTCCTAAACCAACTTCTACAAATGATAAGGCTAGATAGTAAATAT
CTGCTTGTATCATGAATATAAACTGAAAAGTCTATGTGCAACCAGGCGGA
GTTTCGTAACCTCGTACTTCCCATTGAATCTCATCGCATGACGTCCTCAA
AAACTGTACACAACGATCCATTGCTAGAAGGAATCCAGAAATCGAGTCAT
AGATTAAATGCTTACTTAAGTAATTGTTGTCTTTTTTTTTTTTTGCTTAT
GTATTATTTTATGCTAAGTTAGCGATAGATAATTTAATGTTCTTTGACTA
TTTATAGAAAATTTCCATAAACATCATTATTTAAATGACATTATATTTAA
TAAATTAAATTTGCATAAACATCAAAAAAAAAAAAAAAA

FI02019.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG9518-RA 3673 CG9518-RA 2..3672 2..3672 18325 99.9 Plus
CG9517-RA 3255 CG9517-RA 1320..1470 833..983 215 76.1 Plus
CG9517-RB 3358 CG9517-RB 1423..1573 833..983 215 76.1 Plus
CG9517-RA 3255 CG9517-RA 1827..1926 1334..1433 185 79 Plus
CG9517-RB 3358 CG9517-RB 1930..2029 1334..1433 185 79 Plus
CG9517-RA 3255 CG9517-RA 2912..3004 2425..2517 165 78.4 Plus
CG9517-RB 3358 CG9517-RB 3015..3107 2425..2517 165 78.4 Plus
CG9517-RA 3255 CG9517-RA 2177..2229 1687..1739 160 86.7 Plus
CG9517-RB 3358 CG9517-RB 2280..2332 1687..1739 160 86.7 Plus
CG9517-RA 3255 CG9517-RA 1545..1618 1052..1125 145 79.7 Plus
CG9517-RB 3358 CG9517-RB 1648..1721 1052..1125 145 79.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14753231..14756715 3672..189 17045 99.3 Minus
chrX 22417052 chrX 14761244..14761430 188..2 935 100 Minus
chrX 22417052 chrX 14766949..14767330 1433..1052 245 70.9 Minus
chrX 22417052 chrX 14746011..14746143 1181..1049 230 78.2 Minus
chrX 22417052 chrX 14765871..14766044 2517..2344 195 74.1 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG9518-RC 2112 CG9518-PC 1..2112 667..2778 10560 100 Plus
CG9518-RB 2112 CG9518-PB 1..2112 667..2778 10560 100 Plus
CG9518-RA 2112 CG9518-PA 1..2112 667..2778 10560 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:07:16 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG9518-RA 3679 CG9518-RA 8..3678 2..3672 18325 99.9 Plus
CG9518-RC 3952 CG9518-RC 467..3951 188..3672 17395 99.9 Plus
CG9518-RB 3897 CG9518-RB 412..3896 188..3672 17395 99.9 Plus
CG9518-RC 3952 CG9518-RC 8..196 2..190 945 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG9518-PC 703 CG9518-PC 1..703 667..2775 3384 100 Plus
CG9518-PB 703 CG9518-PB 1..703 667..2775 3384 100 Plus
CG9518-PA 703 CG9518-PA 1..703 667..2775 3384 100 Plus
CG9503-PA 626 CG9503-PA 20..623 724..2526 1895 60.1 Plus
CG45065-PA 613 CG45065-PA 3..604 712..2517 1812 58.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14862990..14866473 3672..189 17390 99.9 Minus
X 23542271 X 14870988..14871174 188..2 935 100 Minus
X 23542271 X 14876699..14877080 1433..1052 245 70.9 Minus
X 23542271 X 14855774..14855907 1181..1048 235 78.4 Minus
X 23542271 X 14875621..14875794 2517..2344 195 74.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 14871088..14874571 3672..189 17390 99.9 Minus
X 23527363 X 14879086..14879272 188..2 935 100 Minus
X 23527363 X 14885253..14885403 983..833 215 76.1 Minus
X 23527363 X 14884797..14884896 1433..1334 185 79 Minus
X 23527363 X 14884494..14884546 1739..1687 160 86.7 Minus
X 23527363 X 14863407..14863503 1646..1550 155 77.3 Minus
X 23527363 X 14863943..14864005 1110..1048 150 82.5 Minus
X 23527363 X 14860220..14860306 1658..1572 150 78.1 Minus
X 23527363 X 14885105..14885178 1125..1052 145 79.7 Minus
X 23527363 X 14863872..14863930 1181..1123 145 83 Minus
Blast to na_te.dros performed 2014-11-26 20:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6782..6921 2613..2755 266 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6862 2634..2756 263 69 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6740..6882 2613..2755 256 64.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2328..2473 2613..2755 255 65.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2312..2436 2630..2754 247 69.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6840 2634..2755 243 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2363..2526 2597..2763 242 62.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6780..7014 2581..2817 242 61.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6710..6891 2567..2755 226 60.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2716..2926 2535..2755 208 57.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6801..6949 2581..2735 176 59.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1471..1618 2565..2709 166 61.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2424..2530 2598..2704 148 59.8 Plus
roo 9092 roo DM_ROO 9092bp 1023..1183 2536..2709 137 58.9 Plus
Dvir\Uvir 6564 Dvir\Uvir VIRUVIR 6564bp 122..185 3595..3534 134 71.9 Minus

FI02019.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:23:03 Download gff for FI02019.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14761244..14761430 1..188 99   Minus
chrX 14754274..14756715 189..2629 99 <- Minus
chrX 14753267..14754151 2752..3636 99 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:58:56 Download gff for FI02019.complete
Subject Subject Range Query Range Percent Splice Strand
CG9518-RA 1..2112 667..2778 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:28:16 Download gff for FI02019.complete
Subject Subject Range Query Range Percent Splice Strand
CG9518-RA 1..2112 667..2778 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:58:38 Download gff for FI02019.complete
Subject Subject Range Query Range Percent Splice Strand
CG9518-RA 1..2112 667..2778 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:23:03 Download gff for FI02019.complete
Subject Subject Range Query Range Percent Splice Strand
CG9518-RA 1..2112 667..2778 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-14 17:44:52 Download gff for FI02019.complete
Subject Subject Range Query Range Percent Splice Strand
CG9518-RA 1..3671 2..3673 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:28:16 Download gff for FI02019.complete
Subject Subject Range Query Range Percent Splice Strand
CG9518-RA 1..3671 2..3673 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:58:38 Download gff for FI02019.complete
Subject Subject Range Query Range Percent Splice Strand
CG9518-RA 7..3678 1..3673 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:23:03 Download gff for FI02019.complete
Subject Subject Range Query Range Percent Splice Strand
CG9518-RA 7..3678 1..3673 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:23:03 Download gff for FI02019.complete
Subject Subject Range Query Range Percent Splice Strand
X 14870988..14871174 1..188 99   Minus
X 14862989..14866473 189..3673 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:58:38 Download gff for FI02019.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14765021..14765207 1..188 99   Minus
arm_X 14757022..14760506 189..3673 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:01:00 Download gff for FI02019.complete
Subject Subject Range Query Range Percent Splice Strand
X 14879086..14879272 1..188 99   Minus
X 14871087..14874571 189..3673 99 <- Minus

FI02019.pep Sequence

Translation from 666 to 2777

> FI02019.pep
MVLNLLFITTVIKSTFGVVTTGLWLIPLMLAAITYYRYDAVDPESRPLDQ
LNLYPEYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPS
LAAYLQLSKLDWAYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLY
VRGNRHDYDHWASLGNPGWDYDNVLRYFKKSEDNRNPYLANNKYHGRGGL
LTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQAGFMIAQGTIRRGSR
CSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKHGKVYR
IAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLPVGENMQD
HVGMGGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAF
VHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPI
ANKDSWTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVE
GAKIALRVAEAQVFKQFGSRLWRKPLPNCKQHKFLSDAYLECHVRTISMT
IYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDASIMPTISSGNTNA
PVIMIAEKGADLIKEDWLTNPEYKVKRQANRLRDPDPASSNIQGIITLPN
NITQGDSSNISDRSNMESNFSNSSHINNINFNSNSNSSNIESSSNFTLNY
ANS*

FI02019.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 17:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19432-PA 651 GF19432-PA 1..651 1..694 3100 84.6 Plus
Dana\GF19422-PA 626 GF19422-PA 20..623 20..620 2083 60.4 Plus
Dana\GF19431-PA 612 GF19431-PA 3..604 16..617 1956 57.5 Plus
Dana\GF19429-PA 722 GF19429-PA 43..659 6..619 1819 53.6 Plus
Dana\GF16762-PA 616 GF16762-PA 36..607 45..617 1456 46.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 17:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19438-PA 699 GG19438-PA 1..699 1..703 3553 95.6 Plus
Dere\GG19429-PA 626 GG19429-PA 10..623 10..620 2086 59.6 Plus
Dere\GG19437-PA 867 GG19437-PA 280..858 39..617 1920 58.7 Plus
Dere\GG19436-PA 744 GG19436-PA 43..659 6..619 1805 53.3 Plus
Dere\GG11465-PA 616 GG11465-PA 40..607 49..617 1456 46.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 17:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11960-PA 681 GH11960-PA 1..628 1..628 3283 95.2 Plus
Dgri\GH11953-PA 626 GH11953-PA 10..623 10..620 2087 59.6 Plus
Dgri\GH11959-PA 623 GH11959-PA 3..604 16..617 1967 57.6 Plus
Dgri\GH11957-PA 695 GH11957-PA 43..659 6..619 1854 54.8 Plus
Dgri\GH19466-PA 615 GH19466-PA 35..606 45..617 1463 46.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 17:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG9518-PC 703 CG9518-PC 1..703 1..703 3697 100 Plus
CG9518-PB 703 CG9518-PB 1..703 1..703 3697 100 Plus
CG9518-PA 703 CG9518-PA 1..703 1..703 3697 100 Plus
CG9503-PA 626 CG9503-PA 20..623 20..620 2024 60.1 Plus
CG45065-PA 613 CG45065-PA 3..604 16..617 1935 58.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 17:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15381-PA 681 GI15381-PA 1..628 1..628 3304 96.5 Plus
Dmoj\GI15372-PA 626 GI15372-PA 10..623 10..620 2097 59.9 Plus
Dmoj\GI15380-PA 613 GI15380-PA 3..604 16..617 1979 58.3 Plus
Dmoj\GI15378-PA 695 GI15378-PA 43..689 6..654 1852 53.2 Plus
Dmoj\GI24701-PA 614 GI24701-PA 35..606 45..617 1484 47.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 17:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27090-PA 551 GL27090-PA 1..535 1..568 2723 90.1 Plus
Dper\GL27088-PA 674 GL27088-PA 1..617 6..619 1816 53.5 Plus
Dper\GL21830-PA 614 GL21830-PA 38..609 45..617 1476 46.9 Plus
Dper\GL12187-PA 612 GL12187-PA 35..608 29..617 1278 44.7 Plus
Dper\GL27095-PA 629 GL27095-PA 62..628 57..617 1187 42 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 17:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21849-PA 691 GA21849-PA 1..630 1..630 3332 97 Plus
Dpse\GA21838-PA 626 GA21838-PA 10..623 10..620 2082 59.3 Plus
Dpse\GA22681-PA 623 GA22681-PA 3..604 16..617 1973 57.9 Plus
Dpse\GA21847-PA 712 GA21847-PA 51..655 18..619 1811 54 Plus
Dpse\GA19386-PA 614 GA19386-PA 38..609 45..617 1470 46.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 17:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12016-PA 626 GM12016-PA 10..623 10..620 2088 59.6 Plus
Dsec\GM12028-PA 601 GM12028-PA 1..361 1..361 1878 96.4 Plus
Dsec\GM12023-PA 726 GM12023-PA 43..716 6..693 1807 49.6 Plus
Dsec\GM12026-PA 536 GM12026-PA 7..527 97..617 1726 58.3 Plus
Dsec\GM12030-PA 621 GM12030-PA 30..616 28..616 1357 46.2 Plus
Dsec\GM12028-PA 601 GM12028-PA 348..601 450..703 1141 91.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 17:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15509-PA 505 GD15509-PA 1..500 126..625 2671 98.2 Plus
Dsim\GD15832-PA 864 GD15832-PA 277..855 39..617 1922 58.9 Plus
Dsim\GD21272-PA 616 GD21272-PA 40..607 49..617 1474 46.4 Plus
Dsim\GD22252-PA 633 GD22252-PA 23..624 25..617 1363 46.3 Plus
Dsim\GD15511-PA 621 GD15511-PA 32..616 30..616 1362 46.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 17:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16803-PA 666 GJ16803-PA 1..638 1..639 3303 95 Plus
Dvir\GJ16796-PA 626 GJ16796-PA 10..623 10..620 2099 59.9 Plus
Dvir\GJ16802-PA 862 GJ16802-PA 276..854 39..617 1917 58.5 Plus
Dvir\GJ16801-PA 694 GJ16801-PA 43..672 6..633 1846 54 Plus
Dvir\GJ23917-PA 615 GJ23917-PA 35..606 45..617 1440 46.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 17:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19744-PA 658 GK19744-PA 1..627 1..627 3275 96.2 Plus
Dwil\GK19736-PA 626 GK19736-PA 10..623 10..620 2087 59.6 Plus
Dwil\GK19743-PA 885 GK19743-PA 264..842 40..617 1931 58.6 Plus
Dwil\GK19742-PA 701 GK19742-PA 43..658 6..618 1825 54.1 Plus
Dwil\GK12793-PA 617 GK12793-PA 41..607 49..617 1458 47.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 17:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16091-PA 706 GE16091-PA 1..706 1..703 3579 95.8 Plus
Dyak\GE16081-PA 626 GE16081-PA 10..623 10..620 2083 59.4 Plus
Dyak\GE16090-PA 870 GE16090-PA 283..861 39..617 1921 58.7 Plus
Dyak\GE16089-PA 730 GE16089-PA 43..659 6..619 1825 53.8 Plus
Dyak\GE23657-PA 616 GE23657-PA 40..607 49..617 1481 46.7 Plus

FI02019.hyp Sequence

Translation from 666 to 2777

> FI02019.hyp
MVLNLLFITTVIKSTFGVVTTGLWLIPLMLAAITYYRYDAVDPESRPLDQ
LNLYPEYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPS
LAAYLQLSKLDWAYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLY
VRGNRHDYDHWASLGNPGWDYDNVLRYFKKSEDNRNPYLANNKYHGRGGL
LTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQAGFMIAQGTIRRGSR
CSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKHGKVYR
IAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLPVGENMQD
HVGMGGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAF
VHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPI
ANKDSWTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVE
GAKIALRVAEAQVFKQFGSRLWRKPLPNCKQHKFLSDAYLECHVRTISMT
IYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDASIMPTISSGNTNA
PVIMIAEKGADLIKEDWLTNPEYKVKRQANRLRDPDPASSNIQGIITLPN
NITQGDSSNISDRSNMESNFSNSSHINNINFNSNSNSSNIESSSNFTLNY
ANS*

FI02019.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:16:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG9518-PC 703 CG9518-PC 1..703 1..703 3697 100 Plus
CG9518-PB 703 CG9518-PB 1..703 1..703 3697 100 Plus
CG9518-PA 703 CG9518-PA 1..703 1..703 3697 100 Plus
CG9503-PA 626 CG9503-PA 20..623 20..620 2024 60.1 Plus
CG45065-PA 613 CG45065-PA 3..604 16..617 1935 58.1 Plus