Clone FI02021 Report

Search the DGRC for FI02021

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:20
Well:21
Vector:pFlc-1
Associated Gene/TranscriptCG13594-RA
Protein status:FI02021.pep: gold
Sequenced Size:2911

Clone Sequence Records

FI02021.complete Sequence

2911 bp assembled on 2009-03-10

GenBank Submission: BT072839.1

> FI02021.complete
CAGTTGTAATTGGTGCGTCGAGGCGAGTGGACGCGCTGGCGGATGATTGA
TGCGAACATTGCGTATACGTCGTGTGTGCGGTTCAAACGTTCGGCGGTTG
TGTGTGCGGACTGGGAAGCTGGTGAGCTGAGGAGCACTAGCTAACTCGAG
GACCCGTTAATTGACAGCGGCTAAGGCGGCAAAGGGCGGCAGGTGAGAGC
AGCGAAAGCGGAACCCCAGGCAAAAAACAGAAAGAATTAAGCCAAGTTGA
AGAGCGAGCAAGAAACACCGCCAGCGGGCGGTCCAAAAGCCAACTTCATT
TACGTCTGAAACGCAGTTGAAATAAACGACTTCACGACACTGGCGGATTT
CCTAAAAAACATCCAATCCCTGTGGCTAACGAGCTGGCTCAGCTCCGGGA
AGACCAGCGGGAGGACCAAGCGGAACACCGGCGAAGGATTCGGAATCGGA
GGCGGAGGCCACGAGAAGCGCGCAGTCAACGTTTACACGCTCCAGCAGCC
GCATAAGTTTCCGCTTCAGTTGGACGTGCACGTCGGCGGTAATTGTAGCT
TTGATTGCCACCAGGAGCTGGACAGGATCCGTCAAGCCGGCGTTCCAGCG
CCGCTCCACCAGTCAAAAACACCTTCCTCGGCACGGGCCGGGGAAATCTA
CGAAACCAAGGTTATTGAATGCTCAATGGCCCAGACGATGGACGACATGG
TCTTCCAGTGCAGCAATCAAAACTCGATCTATGTGCTGAATGCCAGCTAC
GGTTCCTATGGGGACTATGGCACATATGCGGCAACAAAGCGTGAAATAAA
TGGCAGCCGGAGCAGAGCAGCAAATCCAATTGGGTCGACTTGCTCGAGTG
GCGTCCTGCAGCATAAATTCAAAACTTTCGGCAGTGCCGCAGCAACAGCA
GCAGCCGCGGCAGCTGCAGCGCCACCAGCCATGGATGCAGCAGCGGGAGG
CGCAGCAAACTACGTAAATCCTGTCGCTACATCAATGTCAACCGCAATGT
GTTCACCGGCAACGGCGGCAACGGCGGCCCTGCAAAAACTGTTCAATTGC
AGCGTCGGCGTCGCCTGCCAAAATGTCACCCACGCCCACAGCAACCACAC
CAACCAAGGCAGCAGCAGCATCAGCAGCAGCCACATCCACATCAGTGGCA
GCAACAACAATGCCGCCGCCAGCAACCATAACAATAGCTGCCTGTCGGCG
GCAGGCGGAGTGGGCCTCCAAGGCGCCCGGAATCGGAGCCGGAGTGGCGA
ATGCCTCGATGGCGCGGCGGGAGCGGTTACCTCGCCAGCCGGAGGCGGAG
GAGCAGGTGGCCTCCCTCTGCTCCCAAAGAAGAAATGCACCAATGTCAAA
TCAGCGCTTATTGCCAAGAAGACAAAGTTTCTCAAATATCTCGAAGAAGA
AAAATGGCGCAGCAACGCGGCAGTTCCGGAAGATGCTGGTGCCATCAGCA
ATGAGGCGGAGCCATCCACCCCGAGCGGCAACAACAACGGCGGCAACTTG
AAAAATCAGAGCAACAGTCGGGAGGCTGGAAGTGGCACTGGAAGTGGCAG
TGGAAGTGGATGTGGAAGTGGGGGGCAGCCGAACAAACCGACCAACTGGA
GCATGCATAATGAGGACACCAGCACGTCGCTGGCCAGCCACCAGCAACTA
CAACAGCAGGCGAAATCGAGTTCCGAGCTCTACCAGGAGGCAGCCGACAT
TTTGGGCCTGAGTTGCAGCCTCTGTGATAATTGCCGATGCCTGGACTGCC
AGAGCGGCTACTTTGACTGCGACGACGACGATGAGAGCTACTCAGAGCAA
TCGCTGATGGACGACGAGTACGACGAGTTCGACTGCGGTGCGGAGGAGCT
GCAGGCGGCGATGACAGCAGCCCGGCACCAGGATGTGCCCCGGATGCCCT
GCTGCCCGCTGGGGGCGAGTTCCCACCTTGCGCACAAGGTGGACTCCCCG
GCCGTACATATGCCCCCGCAATCGGAATCCCTGGGCCATCGGGTGGCCAT
CGATTTTGATTTAATTAACGCCACTTGCAGCCAGGTGCTGCAAAACTGTG
AAACATTCAACGATTTGAGTCTGCTAGATTCCGCCGCCGGAGCCGAGCGT
CCTTTCACGTAAATCCAGGTGACGCGCTGGCAGGCGGGAAATTCCCCGCC
CAATCAGGAGTAGGAGTCCGCACACTGCAGCTAATTAAAGTTTAACAACG
GTCAGGTCGGAGCCCATTAATTGCAACTGACACCTAGCACAGTGGCTGCC
AATTGTACGCGGACACAGCGCGGCTGGTGTTTGCGTTGCATTTATTTTCT
TACTTTTCATTTTGTTTTCAATTAAGTTCGATGCAAATAGAGCATATGGC
TAACGGGAAGCCTCCGCTGCCATATATCCTGCATAAATACGCAATATGTG
GCCTGTGTGTGTGTGGGTGTGTGTGTCTAGTGGCATTGTGCAAACGTGGA
TAGTTGGCGAGCGTGACGAACTGGTCAACAAATCGCAAATAAATTAATTG
GGAATTGCAATTTCAATTCAATCCAATTCCGAAGCAGCGGAAGCTCAATT
GAAAACCAGAAGTGTTCCGGCGATGGCGATTATCAGTGAACATAAACCAC
ATATGGAAAAACAATGAAAACCCAAAGCGAAGTGTGCCAACCAATCTCAT
ATTCAAATATGAATGTTATCGAGTTGCAATGAGTGTAAGCCAAATCGAAT
TCATTGGGATTATGCAGCTCGTAATCTGAAAACACAACTACTTGAAAATT
CAATGAAATATTTATCCCTAATCTGTGTAAAGGGTCTATGTTGTTAGTGC
TTAAGTATGTAAGAATTTTAGTGTGATGCTTTTCGTTCGTTCATTGATTT
CAAATCAAAGAGAAACATTGAAAATATATATTTGTGTTGGAAAAGAAAAA
AAAAAAAAAAA

FI02021.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13594-RA 2897 CG13594-RA 1..2897 1..2897 14470 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20501303..20502094 2895..2116 3655 97.7 Minus
chr2R 21145070 chr2R 20509568..20510245 1448..762 3265 98.7 Minus
chr2R 21145070 chr2R 20506605..20506975 2120..1750 1855 100 Minus
chr2R 21145070 chr2R 20510885..20511205 679..359 1545 98.8 Minus
chr2R 21145070 chr2R 20507253..20507559 1752..1446 1535 100 Minus
chr2R 21145070 chr2R 20523169..20523364 358..163 980 100 Minus
chr2R 21145070 chr2R 20524311..20524473 163..1 815 100 Minus
chr2R 21145070 chr2R 20510345..20510429 763..679 410 98.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13594-RB 1437 CG13594-PB 1..1437 676..2112 7185 100 Plus
CG13594-RA 1437 CG13594-PA 1..1437 676..2112 7185 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:07:17 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13594-RA 2896 CG13594-RA 2..2896 1..2895 14460 100 Plus
CG13594-RB 2855 CG13594-RB 123..2855 163..2895 13650 100 Plus
CG13594-RB 2855 CG13594-RB 2..123 1..122 610 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG13594-PB 478 CG13594-PB 1..478 676..2109 1597 100 Plus
CG13594-PA 478 CG13594-PA 1..478 676..2109 1597 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24615421..24616202 2897..2116 3910 100 Minus
2R 25286936 2R 24623673..24624359 1448..762 3435 100 Minus
2R 25286936 2R 24620700..24621070 2120..1750 1855 100 Minus
2R 25286936 2R 24624999..24625319 679..359 1590 99.7 Minus
2R 25286936 2R 24621348..24621654 1752..1446 1535 100 Minus
2R 25286936 2R 24637283..24637478 358..163 980 100 Minus
2R 25286936 2R 24638425..24638587 163..1 815 100 Minus
2R 25286936 2R 24624459..24624543 763..679 425 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24616620..24617401 2897..2116 3910 100 Minus
2R 25260384 2R 24624872..24625558 1448..762 3435 100 Minus
2R 25260384 2R 24621899..24622269 2120..1750 1855 100 Minus
2R 25260384 2R 24626198..24626518 679..359 1590 99.6 Minus
2R 25260384 2R 24622547..24622853 1752..1446 1535 100 Minus
2R 25260384 2R 24638482..24638677 358..163 980 100 Minus
2R 25260384 2R 24639624..24639786 163..1 815 100 Minus
2R 25260384 2R 24625658..24625742 763..679 425 100 Minus
Blast to na_te.dros performed 2014-11-27 05:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2316..2427 1077..1188 254 69.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2400..2667 887..1161 251 57.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6731..6965 977..1200 248 60.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2268..2505 957..1191 246 58.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6704..6921 971..1183 241 58.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6739..6880 1049..1193 241 66 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2334..2439 1077..1191 202 69.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6692..6836 1056..1191 190 63.4 Plus
roo 9092 roo DM_ROO 9092bp 1079..1187 1086..1195 188 66.1 Plus
roo 9092 roo DM_ROO 9092bp 1079..1153 1110..1184 168 69.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1502..1598 1086..1188 166 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2740..2885 1077..1221 149 62 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1518..1584 1125..1191 146 68.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6818 1098..1191 145 62.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2373 1118..1188 132 67.6 Plus
TAHRE 10463 TAHRE OSV 10463bp 7943..8022 2355..2275 132 64.2 Minus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 120..217 1111..1207 118 59.2 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9150..9247 1111..1207 118 59.2 Plus

FI02021.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:33:42 Download gff for FI02021.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20524312..20524473 1..162 100   Minus
chr2R 20523169..20523364 163..358 100 <- Minus
chr2R 20510885..20511205 359..679 98 <- Minus
chr2R 20510346..20510428 680..762 98 <- Minus
chr2R 20509928..20510244 763..1088 87 <- Minus
chr2R 20509568..20509824 1192..1448 100 == Minus
chr2R 20507253..20507556 1449..1752 85 <- Minus
chr2R 20506607..20506972 1753..2118 100 <- Minus
chr2R 20501303..20502091 2119..2895 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:30:22 Download gff for FI02021.complete
Subject Subject Range Query Range Percent Splice Strand
CG13594-RA 1..1437 676..2112 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:15 Download gff for FI02021.complete
Subject Subject Range Query Range Percent Splice Strand
CG13594-RA 1..1437 676..2112 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:23:30 Download gff for FI02021.complete
Subject Subject Range Query Range Percent Splice Strand
CG13594-RA 1..1437 676..2112 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:33:42 Download gff for FI02021.complete
Subject Subject Range Query Range Percent Splice Strand
CG13594-RA 1..1437 676..2112 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:30:22 Download gff for FI02021.complete
Subject Subject Range Query Range Percent Splice Strand
CG13594-RA 1..2895 1..2895 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:15 Download gff for FI02021.complete
Subject Subject Range Query Range Percent Splice Strand
CG13594-RA 1..2895 1..2895 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:23:30 Download gff for FI02021.complete
Subject Subject Range Query Range Percent Splice Strand
CG13594-RA 2..2896 1..2895 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:33:42 Download gff for FI02021.complete
Subject Subject Range Query Range Percent Splice Strand
CG13594-RA 2..2896 1..2895 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:33:42 Download gff for FI02021.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24638426..24638587 1..162 100   Minus
2R 24637283..24637478 163..358 100 <- Minus
2R 24624999..24625319 359..679 99 <- Minus
2R 24624460..24624542 680..762 100 <- Minus
2R 24623673..24624358 763..1448 100 <- Minus
2R 24621348..24621651 1449..1752 100 <- Minus
2R 24620702..24621067 1753..2118 100 <- Minus
2R 24615423..24616199 2119..2895 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:23:30 Download gff for FI02021.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20525949..20526110 1..162 100   Minus
arm_2R 20524806..20525001 163..358 100 <- Minus
arm_2R 20512522..20512842 359..679 99 <- Minus
arm_2R 20511983..20512065 680..762 100 <- Minus
arm_2R 20511196..20511881 763..1448 100 <- Minus
arm_2R 20508871..20509174 1449..1752 100 <- Minus
arm_2R 20508225..20508590 1753..2118 100 <- Minus
arm_2R 20502946..20503722 2119..2895 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:16 Download gff for FI02021.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24639643..24639804 1..162 100   Minus
2R 24638500..24638695 163..358 100 <- Minus
2R 24626216..24626536 359..679 99 <- Minus
2R 24625677..24625759 680..762 100 <- Minus
2R 24624890..24625575 763..1448 100 <- Minus
2R 24622565..24622868 1449..1752 100 <- Minus
2R 24621919..24622284 1753..2118 100 <- Minus
2R 24616640..24617416 2119..2895 100 <- Minus

FI02021.pep Sequence

Translation from 675 to 2111

> FI02021.pep
MAQTMDDMVFQCSNQNSIYVLNASYGSYGDYGTYAATKREINGSRSRAAN
PIGSTCSSGVLQHKFKTFGSAAATAAAAAAAAPPAMDAAAGGAANYVNPV
ATSMSTAMCSPATAATAALQKLFNCSVGVACQNVTHAHSNHTNQGSSSIS
SSHIHISGSNNNAAASNHNNSCLSAAGGVGLQGARNRSRSGECLDGAAGA
VTSPAGGGGAGGLPLLPKKKCTNVKSALIAKKTKFLKYLEEEKWRSNAAV
PEDAGAISNEAEPSTPSGNNNGGNLKNQSNSREAGSGTGSGSGSGCGSGG
QPNKPTNWSMHNEDTSTSLASHQQLQQQAKSSSELYQEAADILGLSCSLC
DNCRCLDCQSGYFDCDDDDESYSEQSLMDDEYDEFDCGAEELQAAMTAAR
HQDVPRMPCCPLGASSHLAHKVDSPAVHMPPQSESLGHRVAIDFDLINAT
CSQVLQNCETFNDLSLLDSAAGAERPFT*

FI02021.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:14:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11919-PA 539 GF11919-PA 1..539 5..478 1210 57.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19908-PA 487 GG19908-PA 1..487 5..478 1768 83.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21575-PA 709 GH21575-PA 170..709 2..478 836 45 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:14:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG13594-PB 478 CG13594-PB 1..478 1..478 2510 100 Plus
CG13594-PA 478 CG13594-PA 1..478 1..478 2510 100 Plus
CG3257-PA 447 CG3257-PA 143..422 98..374 194 25.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19547-PA 713 GI19547-PA 142..713 2..478 829 43.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10102-PA 668 GL10102-PA 138..668 2..478 1124 52.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12387-PB 521 GA12387-PB 1..521 5..478 1110 53.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11809-PA 481 GM11809-PA 1..481 1..478 1940 89.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24933-PA 606 GD24933-PA 125..606 1..478 1946 90.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21119-PA 546 GJ21119-PA 1..546 5..478 882 46.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21878-PA 545 GK21878-PA 7..419 13..398 577 41.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11432-PA 477 GE11432-PA 1..477 5..478 1816 84.6 Plus

FI02021.hyp Sequence

Translation from 675 to 2111

> FI02021.hyp
MAQTMDDMVFQCSNQNSIYVLNASYGSYGDYGTYAATKREINGSRSRAAN
PIGSTCSSGVLQHKFKTFGSAAATAAAAAAAAPPAMDAAAGGAANYVNPV
ATSMSTAMCSPATAATAALQKLFNCSVGVACQNVTHAHSNHTNQGSSSIS
SSHIHISGSNNNAAASNHNNSCLSAAGGVGLQGARNRSRSGECLDGAAGA
VTSPAGGGGAGGLPLLPKKKCTNVKSALIAKKTKFLKYLEEEKWRSNAAV
PEDAGAISNEAEPSTPSGNNNGGNLKNQSNSREAGSGTGSGSGSGCGSGG
QPNKPTNWSMHNEDTSTSLASHQQLQQQAKSSSELYQEAADILGLSCSLC
DNCRCLDCQSGYFDCDDDDESYSEQSLMDDEYDEFDCGAEELQAAMTAAR
HQDVPRMPCCPLGASSHLAHKVDSPAVHMPPQSESLGHRVAIDFDLINAT
CSQVLQNCETFNDLSLLDSAAGAERPFT*

FI02021.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG13594-PB 478 CG13594-PB 1..478 1..478 2510 100 Plus
CG13594-PA 478 CG13594-PA 1..478 1..478 2510 100 Plus
CG3257-PA 447 CG3257-PA 143..422 98..374 194 25.4 Plus