Clone FI02064 Report

Search the DGRC for FI02064

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:20
Well:64
Vector:pFlc-1
Associated Gene/TranscriptCG8910-RA
Protein status:FI02064.pep: gold
Sequenced Size:3421

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8910 2008-12-18 5.12 accounting

Clone Sequence Records

FI02064.complete Sequence

3421 bp assembled on 2008-11-12

GenBank Submission: BT053672.1

> FI02064.complete
AGTCGCACTCGCAGGCGCTACGGGGCAGGTTGCTTGATACGGCAGCATAC
GCGGCGTATACGTAACGTGGAAAAAGGACAAGATTTTTTCAATGCAAAAT
TGATTGCAGCGTATCAGCGGCAAATTTAGCAAACAGAAAACAGCATGCGA
AGGAAAAAGAAAAGTGTAATGATAGCGCCAAGGAACCAAATCCGACTTTA
GTGCCAATTGTGCCGTGCGAAATGCTGTTAGTGCCGCGTTGTTGTTCGTG
TCCATGTTGTGATTACATAATGAGACGCTGCTGAAAGTCAAAGTCCAAGG
AGAAGTCCCAAGTGTGTATGTAAGCCAGGCGGCAGCCATATCTCAACTTG
CCGCCACTAACTCAGCCGAAGTAGAAGGCGAAGCAAAAGCCTAAGGACCA
GCCCTCCATCTGCAGGATAACGAGGAGCGTGAGGAGCCGCAGGAGGATGC
CCTTCGGCCGCAAGTCCCCGCTGGAGGCACTGGCCCTTCCCGGCGTCATG
CTCGCCTACAAGTACAGCCAGTTCCGCCAGCGCCGCCGGGAGGCCGCCAG
CCGACGGGTCACCGAGCGCGAACTCTCGGCGCTGCACCATAAAATCGACA
AACTACTGAGTAAACTGGAGGAGGAAAGCGAGCCGGATCCTCCAACCTCC
CAGGAGGACGAATGTGTGATCTGCATCAATGCCCGGGCCACCATGCAGAC
ATCGCCATGTGGCCACCGCGTCGTCTGCCGCCGCTGCTTTGTGAAGACCA
TTCAGAGTGCGGTGGCCCAACGACTGTTGCCCCTTCGCTGCGTCATTTGT
CGAGCGCGGGTCAATCGTCTGACCTCGTCCTCGGGCACTTGGCGAATCCA
GGAGTCGGCCAGCAGCTACTCAATGGGCGCCAAGAGTTGGGCCTCCGCCG
GAGTGGCCGCCGGCGGTGTGGTACCCTCGGCGAGCTCCTACTCGATGAAC
GATGCGCACAGCGGCCACCATTCGTTCCACCAGCCCACGCTGCACAAGTC
GGCGGTGGGACGGCATCACCCGCATCATTACGCCGCCCGAGGATCAGCCC
ATGCTCGAGTCTCCCAGTCGGACAGCCTGTACTCGATGAGCTCGACGGGA
TCGGCGGCTTCATCGGCCTCCGGTTATTCACACTACTCCAAGACGTCTTC
CATATCGAGCAACGGTCCCTGCTCACCGGCCTCGCCGGCCGTGGCTTCCA
GCTCCAATCACCTGGCACCGCCATCGCCCACCACCCACCATCACAGTCAT
AGTCTGGCCTCACCCACTCCATCGGGATCATCGGGCAGTTCCCTTTCACC
GCGGGAAAATGGAACTTCACATTCGCATCATGGTGGGTGTCCCATTGGTT
GCTCCGGTGCCGTGCCAAGAAAACCGCTTCACACGCTCACCAATAGCTCA
TCCACGCCCATTTCCGGTTCATCGTCGAGCGGAAGTGGGGGAGGAGGAGT
GGGCAACGGCAACGGTAGTGTACCAAGTGGAATGATGACGCCTACGCATA
CGTATCCTGGCCGAAGGCATGTAAAGAACCGACTGATGGACATCCAGAAC
CGCCTGCCGCCGATCAAGGAGTTCCGCAGTCCGGCCAAAGTGCCGCATCC
TTCGCCCGTGCACGTCAGCAATCCCAGATTTCGTTACTCCACTTATACAA
AGTCCAGTGCCCATGAACTGGCTCCGTTGCTGCGTGAATCCGGATCGTCG
CCTCCGCCACGTCGCCCCAGTCCGATGAACATCCAGCTGAGCTGCTCCGC
ACTGGCCCCGCCCCCTTTGAAGGCGGGCGGGGCAAAGATCTGCCCACTGA
CCTCGAAGAACTCGCTGCCGAAAAACGCTTACGTGATGCCCAAGGATAAG
AAGCAGCCAGCTTCTGTTCCGCAAGGGAAAGCTACTGGTACTGCCTCCAA
GTCGACTCCACAAGGAGCAGGCTGCTCGAGGGCATCAGCTGGATGTTCTG
CTGCCAATTCAGGATCAACTGGAGCTGGATCGGCTAGTAATCCCAAGCCC
TCGTCAAGCTCTTCCAGTCGCAGTTTTCCGCTTTTCTCCGCCGCCAGTAA
TCAGAGAGAGAAGGCTGACAATAAGAAGAACGAATCTGTTGAGCGCAAGA
AAAAGGAGGAAAAGCTCAAGCTGAAGGCTGAGAAGGAAGCCAGAAAGGAG
GAAAAGCGACTGGCCAAGGAGGAGGAGCGTCTGGCCAAGCTGCACGCCAA
GGAGGAGAAGAAGCGGGGCAAGAAGGAGGCCAAGGAGCTGCTGTTGGCCA
ACGATGGGAACAGCAAGAAGTGAGGGAAGGGCACCCAATTAGCCAGCAAA
AACGCATATTTCCAGTTGCAATTCTAGCCATGTAAGATCATCACCAAGTA
CCCGTGTAACCGTACTATATCAAGCCAAATAGGATCGGATGGAATCAGAC
CTCCAACTCACACACCTCAACACCCCCTACCCATATGAATCGAGCTTGAT
TGTAATTTTATGAACGTAATTTGTCAGTTAGGCCTCAATCATTTCCATGA
TTTTTTACTCGAAATAGAAAATAGAGAAGCCAAATATTTAAAAATAGTTT
CTTAAAAAAAAGAATTCACTGTAGAATCGTGAAATTTAAATCACCTTCAT
TGTACTTGTGTCTGCATATTTACTTCTTTTGTGGGCGTTTTTGGCATTTA
ATGCTTTTAATTCAAAAGAAAAACTATGCCAAACATTTGTATTTAAATGA
TAAACCTTTGGCAAGCACTGATTTTTTCACTAATATTTTGCTTTCATTTC
GTTTATAGTCGTAAGCAGAAACTTCCACTTAGTTTTCATTACGTTCACTG
CCCACTTTCATAACTCTTCACCGTCTAGAGATATGATAAGAATAGGATGA
TATTGCTGCCTTTCGTTCGACATTGCCTCAGTCTCAGTCTCAACATGAAT
CATTACCAATTAAAAAGGTTGTTGAAACAATTTCAATTTGAACAGATTCT
GATGAAAATATCCGTAACAGTCCTTTTTACTTTCAAGTTTCCATATACTA
GACTACCAAACAGAATACCCCTTAATAGAGAGAACCTCATCTCGAGATAT
AGAACCATGACCACTGAATGGCAAACCAATGTTAGAGCCAAGCTTTAGCA
AACGTAAGCCAGAATCTGAATAAATTAATAACTATGTACTACCAGTATGT
TAACATGTTTACAAAAAGCGAGAGCATATTAAAGTAGTTTTCATATACCC
CTCTATATATATTATATATATATATCTGTATCTGTAACTAAATCTATAGA
ATCCATACCTATATTGGAAACTGTTCAAATGCAAACATAAGCAATGTTTC
GATGTATGTACGTGTATATGTGTTACCAGGATTGTTTTAAAAACAGACAA
ATATATCCCCGAAAAGTGGGAAACGATGAAACCCAATAAAGAATCAATTA
TGTCGAAAAAAAAAAAAAAAA

FI02064.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG8910-RA 3405 CG8910-RA 1..3403 1..3403 17000 99.9 Plus
CG8910.a 3447 CG8910.a 133..3445 91..3403 16550 99.9 Plus
CG6435-RA 794 CG6435-RA 538..794 3408..3152 1270 99.6 Minus
CG8910.a 3447 CG8910.a 1..90 1..90 450 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:29:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12761887..12763144 3403..2146 6200 99.5 Minus
chr2R 21145070 chr2R 12764162..12765198 1633..597 5185 100 Minus
chr2R 21145070 chr2R 12781277..12781783 597..91 2535 100 Minus
chr2R 21145070 chr2R 12763666..12764093 2060..1633 2095 99.3 Minus
chr2R 21145070 chr2R 12763502..12763594 2148..2056 450 98.9 Minus
chr2R 21145070 chr2R 12782720..12782809 90..1 450 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:29:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG8910-RA 1827 CG8910-PA 1..1827 447..2273 9135 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:07:37 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:29:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG8910-RA 3406 CG8910-RA 2..3404 1..3403 17000 100 Plus
CG6435-RA 794 CG6435-RA 543..794 3403..3152 1260 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG8910-PA 608 CG8910-PA 1..548 447..2090 1427 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16874721..16875983 3408..2146 6285 99.8 Minus
2R 25286936 2R 16877001..16878037 1633..597 5185 100 Minus
2R 25286936 2R 16894119..16894625 597..91 2535 100 Minus
2R 25286936 2R 16876505..16876932 2060..1633 2125 99.8 Minus
2R 25286936 2R 16876341..16876433 2148..2056 465 100 Minus
2R 25286936 2R 16895562..16895651 90..1 450 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16875920..16877182 3408..2146 6285 99.8 Minus
2R 25260384 2R 16878200..16879236 1633..597 5185 100 Minus
2R 25260384 2R 16895318..16895824 597..91 2535 100 Minus
2R 25260384 2R 16877704..16878131 2060..1633 2125 99.7 Minus
2R 25260384 2R 16877540..16877632 2148..2056 465 100 Minus
2R 25260384 2R 16896761..16896850 90..1 450 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:29:35 has no hits.

FI02064.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:30:53 Download gff for FI02064.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12782720..12782809 1..90 100   Minus
chr2R 12781278..12781783 91..596 100 <- Minus
chr2R 12764162..12765198 597..1633 100 <- Minus
chr2R 12763671..12764092 1634..2055 99 <- Minus
chr2R 12763503..12763594 2056..2147 98 <- Minus
chr2R 12761885..12763142 2148..3405 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:35:24 Download gff for FI02064.complete
Subject Subject Range Query Range Percent Splice Strand
CG8910-RA 1..1827 447..2273 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:20:19 Download gff for FI02064.complete
Subject Subject Range Query Range Percent Splice Strand
CG8910-RA 1..1827 447..2273 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:01:58 Download gff for FI02064.complete
Subject Subject Range Query Range Percent Splice Strand
CG8910-RA 1..1827 447..2273 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:30:53 Download gff for FI02064.complete
Subject Subject Range Query Range Percent Splice Strand
CG8910-RA 1..1827 447..2273 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:35:23 Download gff for FI02064.complete
Subject Subject Range Query Range Percent Splice Strand
CG8910-RA 1..3405 1..3405 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:20:19 Download gff for FI02064.complete
Subject Subject Range Query Range Percent Splice Strand
CG8910-RA 1..3405 1..3405 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:01:58 Download gff for FI02064.complete
Subject Subject Range Query Range Percent Splice Strand
CG8910-RA 2..3406 1..3405 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:30:53 Download gff for FI02064.complete
Subject Subject Range Query Range Percent Splice Strand
CG8910-RA 2..3406 1..3405 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:30:53 Download gff for FI02064.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16895562..16895651 1..90 100   Minus
2R 16894120..16894625 91..596 100 <- Minus
2R 16877001..16878037 597..1633 100 <- Minus
2R 16876510..16876931 1634..2055 100 <- Minus
2R 16876342..16876433 2056..2147 100 <- Minus
2R 16874724..16875981 2148..3405 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:01:58 Download gff for FI02064.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12783067..12783156 1..90 100   Minus
arm_2R 12781625..12782130 91..596 100 <- Minus
arm_2R 12764506..12765542 597..1633 100 <- Minus
arm_2R 12764015..12764436 1634..2055 100 <- Minus
arm_2R 12763847..12763938 2056..2147 100 <- Minus
arm_2R 12762229..12763486 2148..3405 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:51:46 Download gff for FI02064.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16896761..16896850 1..90 100   Minus
2R 16895319..16895824 91..596 100 <- Minus
2R 16878200..16879236 597..1633 100 <- Minus
2R 16877709..16878130 1634..2055 100 <- Minus
2R 16877541..16877632 2056..2147 100 <- Minus
2R 16875923..16877180 2148..3405 99 <- Minus

FI02064.pep Sequence

Translation from 446 to 2272

> FI02064.pep
MPFGRKSPLEALALPGVMLAYKYSQFRQRRREAASRRVTERELSALHHKI
DKLLSKLEEESEPDPPTSQEDECVICINARATMQTSPCGHRVVCRRCFVK
TIQSAVAQRLLPLRCVICRARVNRLTSSSGTWRIQESASSYSMGAKSWAS
AGVAAGGVVPSASSYSMNDAHSGHHSFHQPTLHKSAVGRHHPHHYAARGS
AHARVSQSDSLYSMSSTGSAASSASGYSHYSKTSSISSNGPCSPASPAVA
SSSNHLAPPSPTTHHHSHSLASPTPSGSSGSSLSPRENGTSHSHHGGCPI
GCSGAVPRKPLHTLTNSSSTPISGSSSSGSGGGGVGNGNGSVPSGMMTPT
HTYPGRRHVKNRLMDIQNRLPPIKEFRSPAKVPHPSPVHVSNPRFRYSTY
TKSSAHELAPLLRESGSSPPPRRPSPMNIQLSCSALAPPPLKAGGAKICP
LTSKNSLPKNAYVMPKDKKQPASVPQGKATGTASKSTPQGAGCSRASAGC
SAANSGSTGAGSASNPKPSSSSSSRSFPLFSAASNQREKADNKKNESVER
KKKEEKLKLKAEKEARKEEKRLAKEEERLAKLHAKEEKKRGKKEAKELLL
ANDGNSKK*

FI02064.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13442-PA 624 GF13442-PA 1..624 1..608 2119 83.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22238-PA 607 GG22238-PA 1..607 1..608 2479 97.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23145-PA 612 GH23145-PA 1..612 1..608 1693 69.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG8910-PA 608 CG8910-PA 1..608 1..608 3163 100 Plus
spen-PH 5458 CG18497-PH 1490..1912 208..597 172 22.5 Plus
spen-PC 5476 CG18497-PC 1508..1930 208..597 172 22.5 Plus
spen-PG 5487 CG18497-PG 1492..1914 208..597 172 22.5 Plus
spen-PE 5505 CG18497-PE 1510..1932 208..597 172 22.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:13:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18482-PA 601 GI18482-PA 1..601 1..608 1937 77.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10502-PA 621 GL10502-PA 1..618 1..603 1840 78.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21404-PA 621 GA21404-PA 1..618 1..603 1840 78.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20024-PA 607 GM20024-PA 1..607 1..608 2500 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25510-PA 607 GD25510-PA 1..607 1..608 2508 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21343-PA 604 GJ21343-PA 1..604 1..608 1950 74.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21313-PA 640 GK21313-PA 1..640 1..608 1900 73.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14029-PA 607 GE14029-PA 1..607 1..608 2475 96.7 Plus

FI02064.hyp Sequence

Translation from 446 to 2272

> FI02064.hyp
MPFGRKSPLEALALPGVMLAYKYSQFRQRRREAASRRVTERELSALHHKI
DKLLSKLEEESEPDPPTSQEDECVICINARATMQTSPCGHRVVCRRCFVK
TIQSAVAQRLLPLRCVICRARVNRLTSSSGTWRIQESASSYSMGAKSWAS
AGVAAGGVVPSASSYSMNDAHSGHHSFHQPTLHKSAVGRHHPHHYAARGS
AHARVSQSDSLYSMSSTGSAASSASGYSHYSKTSSISSNGPCSPASPAVA
SSSNHLAPPSPTTHHHSHSLASPTPSGSSGSSLSPRENGTSHSHHGGCPI
GCSGAVPRKPLHTLTNSSSTPISGSSSSGSGGGGVGNGNGSVPSGMMTPT
HTYPGRRHVKNRLMDIQNRLPPIKEFRSPAKVPHPSPVHVSNPRFRYSTY
TKSSAHELAPLLRESGSSPPPRRPSPMNIQLSCSALAPPPLKAGGAKICP
LTSKNSLPKNAYVMPKDKKQPASVPQGKATGTASKSTPQGAGCSRASAGC
SAANSGSTGAGSASNPKPSSSSSSRSFPLFSAASNQREKADNKKNESVER
KKKEEKLKLKAEKEARKEEKRLAKEEERLAKLHAKEEKKRGKKEAKELLL
ANDGNSKK*

FI02064.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:19:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG8910-PA 608 CG8910-PA 1..608 1..608 3163 100 Plus
spen-PH 5458 CG18497-PH 1490..1912 208..597 172 22.5 Plus
spen-PC 5476 CG18497-PC 1508..1930 208..597 172 22.5 Plus
spen-PG 5487 CG18497-PG 1492..1914 208..597 172 22.5 Plus
spen-PE 5505 CG18497-PE 1510..1932 208..597 172 22.5 Plus