Clone FI02065 Report

Search the DGRC for FI02065

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:20
Well:65
Vector:pFlc-1
Associated Gene/TranscriptCG9795-RD
Protein status:FI02065.pep: gold
Sequenced Size:2829

Clone Sequence Records

FI02065.complete Sequence

2829 bp assembled on 2009-01-05

GenBank Submission: BT056235.1

> FI02065.complete
CTCTAAAATAAATGCCTAATGAATTGGCTCAGTTCCGTTGTGCGCTTAAT
TTTTTGTCGCTGCTCAAACTGAATGTTTCCGCCTGTCAGAACACCGTATG
CAAAACCGTGACCGCGCCCACGCCGTGCTTGAAAGTCCAATACATTTAAT
CCGCAATTGTGACGCAAAAGCAACATGAGCGTTTTGCGGGAGGAAACGAC
AACTTCCAGCCAGAGGGAGATAAGCACAAACGGCGGTGGGTTGGATTTCC
CCGCAGAAGTGACGTCGCTGATTGCTGGCAACAGCTTTTGCTTAACGCCA
GGAAATAACGGCGGGATCGGTGCCCAGAAAAAGGTCACTACTGGAGCGGG
TCTGAACAGTACACAGAGAGCTACGGATGCCACCAAGCGCAAGAAACTAA
GGTCGCGTAACGTACCACCTTCCCCATTGGCCCAAAAAACTGAAGCAGCG
GCGACCTCTCTTAACCAAACGAACATCGGTGAGGTCAAGAGAACCGATAT
TAACTATTCCAACGATCACCTTGATGCCTGGTTGGAGAGCTGTTTACGTG
ATGCCACCAACGCCCAATTGTCTTCTTCATCTGAGTTTTTGGACTTCATA
CCGCCCACAGCACCAGCTCATAAGCAAATGTTTTTGACTCAACAGCAGCA
GCTGCCGCAGCTTAAACAGCAACTACAGCAGCAGAGGCAACAGGAATTTT
CGAAGCGAACCCAGCCTTACGGAGTGGGTCCAGGCACACCGTTTAGCCTG
GGGATACAGCGCAATTCGAACTCTCTTAGCCATCGATATCCGATGCTCTT
CCCACCCCAGAGCCTTAACAGCTATGGTGATGGTGGCCAGGAGTTTGCAA
GCTTGCCTCCCCTGAACAACATGATGGGAGGGCCGGAAGGGCTTGGGTGC
GATCAGGAACCGAATTCGACGGATGTGCTGGATGGCAGCGAAAGCAATCC
CAACTTTACCAAGGGATTTCGGTTCAGCGATCCGTGCCTACTGAACCCCT
CCGATAATGACTCTAAGCTGAGTGGCCAGAATACACCAGAGTGTCGAAAT
GTGAACAACAATGGCAGTGGCTGTGATCTGGCACATCAAAACAAATTTTT
CGCGGCTCTAATGGAACAAATAAACATATTGCACGACACCAATTCCAAGA
TCTGCCGGAATTTGCATAATACAAAAGTTGATATCGAAGCTTTAAAGCAC
TCCCCTAATAGCCAGCACTGGGCAGGTGTAGGCTTTGGGGGCATGCGGCA
CCGTAGAGATAGCTTAAGCGGGCTAAGCACACAAAGTCAACCTCTTATTC
TTGGCAGTGGATTGGGAGGGACACACAGCCCAGCGCCCACATTTCACTCA
GGCGCCTACACTCCAGGAATGATGACGGATGTCGTGCGGGAAGTGAAGGA
GGCAGCGCGCATACGCGAAGATGCACTGCTAAGTCGAGTAAAATTAATGG
TTGAAGAACGTCAGTGTTCCTTAAACGAGGGAAATGTCCGAATTCTGAGA
GATATAGACGATCTAAAGACCCAAGTAATGCAGTTGCGACTGGAGAAAAA
GGAGACTAACAAACGCCTCTCACATCTGGAATCCGAAAACAAGTGCCTTC
GTCAAGCTCTGGCCGGTTGTTATAACCAGCGGCCAATCAGTAACGACATT
ATTTACGAAAATGACCGATCCCATGGATTCCGAAAGCCATTTCCGAATGG
GGGTGGCGGCGGAGTTGTGGGTTCCGGTGCCCTCGGAATACGACGGGCAA
AATCTTTAAACCTTCATTATGGAACAATGCATCAAACGCCTATCCAAACG
ACACACTCTTTGGAAGAGGACGACGAAATAGAAGAGGAGCAGTTAGTAGA
GCAAGTAGGACTGGACGGAGAAGAATTATCCCTGACTGGCAACAACAGTT
TATCGTGTTTGAACATCGGTCATCAATCTCCCTCCAACTTAACGCCTCAC
TCACAGATACCTAAATCAGAAAAGCAAGCAGTTAGAAGCCCTCCCTCTTT
TGCGCTGGCTTCTGACCAGATCAATCCGGGAATTCCACCGCCATTGCTAC
CACGAAAGAAGGACCACGCTCATCTAAAGCGGGAGCGCAGCGAGGCGGCC
TCCGTACGTAAGGAGACAAATCAACGTATAATTGCCCTTGAGAAATTGGT
TGAAGACCTAAGTGACCAGGTGAGAGGTAAGACAAAGAGGAACCCGACCG
TATCAAGCACTGCAGCGGACATAACGCTATCATCGAAATTCAGCGTGGCG
GACGCTCCGATTACGGACTTATAGTTTTAGCTATAAGCCGCCTCAAAAGC
AAAAGGGTTGCGCCAACACAAAATGCGTGTCACTCACTTATAGCATTTGG
ATACACGACAATTATCACATCAACGACACTTCATCTTATGTTTCAAAATT
TATTATAACCCAATAACCTGTGCGTAAGCTCAAATGTATTAACTAGAATG
CTTTTACCAAGTGTCAACTGTAATTTAAAATTTTGAAACTCATTGTTTTT
TGTCTACTAAAAATAAATGTCACTAAATTTTTAAATGAATATGGTCCATA
AATTATTTAATTCATTTTGAGTTAATTGAGATGCATTGCACAACAGTGTT
TGTATTTTGTGGATGATTAACTAAGAAAACCTGTACCTATCGAAATGAAC
AAAAATCAAAATCTATATAGACGCAAAAAGCCTAGAATTTAAATAATAAT
TAAGTAGGTTGAATAATGAAAATTGTTAACCATATTTGTTAAGTGCCATT
TAATTAAAAAAATGTAAAAATGTAATATATTCATATAAATAGACATAAAC
ATAAACATTAACGAAAAAAAAAAAAAAAA

FI02065.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG9795-RD 2891 CG9795-RD 25..2835 1..2812 14020 99.9 Plus
CG9795.e 3031 CG9795.e 242..2885 168..2812 13185 99.9 Plus
CG9795.b 3045 CG9795.b 242..2885 168..2812 13185 99.9 Plus
CG9795.e 3031 CG9795.e 41..207 1..167 835 100 Plus
CG9795.b 3045 CG9795.b 41..207 1..167 835 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:33:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 151417..152092 2136..2812 3335 99.9 Plus
chr3R 27901430 chr3R 150591..151209 1517..2135 3095 100 Plus
chr3R 27901430 chr3R 148949..149342 369..762 1970 100 Plus
chr3R 27901430 chr3R 149672..149884 965..1177 1065 100 Plus
chr3R 27901430 chr3R 147565..147767 168..370 1015 100 Plus
chr3R 27901430 chr3R 149407..149609 763..965 1015 100 Plus
chr3R 27901430 chr3R 150055..150231 1176..1352 885 100 Plus
chr3R 27901430 chr3R 145410..145576 1..167 835 100 Plus
chr3R 27901430 chr3R 150304..150392 1348..1436 445 100 Plus
chr3R 27901430 chr3R 150449..150531 1436..1518 415 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG9795-RE 2211 CG9795-PE 105..2211 168..2274 10535 100 Plus
CG9795-RD 2100 CG9795-PD 1..2100 175..2274 10500 100 Plus
CG9795-RF 2082 CG9795-PF 105..2072 168..2135 9840 100 Plus
CG9795-RE 2211 CG9795-PE 1..70 98..167 350 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:07:39 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9795-RD 2825 CG9795-RD 8..2818 1..2812 14010 100 Plus
CG9795-RE 2573 CG9795-RE 209..2573 168..2532 11825 100 Plus
CG9795-RF 2390 CG9795-RF 209..2176 168..2135 9840 100 Plus
CG9795-RE 2573 CG9795-RE 8..174 1..167 835 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG9795-PE 736 CG9795-PE 36..736 169..2271 3354 100 Plus
CG9795-PD 699 CG9795-PD 1..699 175..2271 3344 100 Plus
CG9795-PF 693 CG9795-PF 36..691 169..2136 3138 100 Plus
CG9795-PA 501 CG9795-PA 23..493 694..2106 2337 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4325697..4326372 2136..2812 3335 99.9 Plus
3R 32079331 3R 4324871..4325489 1517..2135 3095 100 Plus
3R 32079331 3R 4323229..4323622 369..762 1970 100 Plus
3R 32079331 3R 4323952..4324164 965..1177 1065 100 Plus
3R 32079331 3R 4321845..4322047 168..370 1015 100 Plus
3R 32079331 3R 4323687..4323889 763..965 1015 100 Plus
3R 32079331 3R 4324335..4324511 1176..1352 885 100 Plus
3R 32079331 3R 4319690..4319856 1..167 835 100 Plus
3R 32079331 3R 4324584..4324672 1348..1436 445 100 Plus
3R 32079331 3R 4324729..4324811 1436..1518 415 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4066528..4067203 2136..2812 3345 99.8 Plus
3R 31820162 3R 4065702..4066320 1517..2135 3095 100 Plus
3R 31820162 3R 4064060..4064453 369..762 1970 100 Plus
3R 31820162 3R 4064783..4064995 965..1177 1065 100 Plus
3R 31820162 3R 4064518..4064720 763..965 1015 100 Plus
3R 31820162 3R 4062676..4062878 168..370 1015 100 Plus
3R 31820162 3R 4065166..4065342 1176..1352 885 100 Plus
3R 31820162 3R 4060521..4060687 1..167 835 100 Plus
3R 31820162 3R 4065415..4065503 1348..1436 445 100 Plus
3R 31820162 3R 4065560..4065642 1436..1518 415 100 Plus
Blast to na_te.dros performed 2014-11-27 09:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6761..6849 608..695 181 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6869..6922 640..693 171 79.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6740..6848 608..715 155 61.5 Plus
roo 9092 roo DM_ROO 9092bp 1124..1184 640..701 155 76.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2362 640..695 154 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2343..2399 640..696 150 73.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6806..6911 605..706 150 64.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6773..6858 605..692 147 64.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2364..2420 640..696 141 71.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6731..6787 640..696 141 71.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6752..6808 640..696 141 71.9 Plus
roo 9092 roo DM_ROO 9092bp 1079..1135 640..696 141 71.9 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3291..3364 640..713 136 64.9 Plus
Juan 4236 Juan JUAN 4236bp 1675..1802 2599..2472 134 60 Minus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 639..715 717..641 133 63.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2820..2870 640..693 128 74.1 Plus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 672..726 693..639 122 69.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2322..2374 640..692 121 69.8 Plus
roo 9092 roo DM_ROO 9092bp 1079..1162 605..693 118 62.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2763..2856 599..691 116 59.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2790..2832 640..682 116 74.4 Plus

FI02065.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:28:29 Download gff for FI02065.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 151417..152092 2136..2813 93   Plus
chr3R 150593..151209 1519..2135 100 -> Plus
chr3R 150450..150531 1437..1518 100 -> Plus
chr3R 150308..150392 1352..1436 100 -> Plus
chr3R 150057..150230 1178..1351 100 -> Plus
chr3R 149673..149884 966..1177 100 -> Plus
chr3R 149407..149609 763..965 100 -> Plus
chr3R 149274..149342 694..762 100 -> Plus
chr3R 148951..149219 371..639 100 == Plus
chr3R 147565..147767 168..370 100 -> Plus
chr3R 145410..145576 1..167 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:50:04 Download gff for FI02065.complete
Subject Subject Range Query Range Percent Splice Strand
CG9795-RD 1..2100 175..2274 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:22:01 Download gff for FI02065.complete
Subject Subject Range Query Range Percent Splice Strand
CG9795-RD 1..2100 175..2274 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:36:01 Download gff for FI02065.complete
Subject Subject Range Query Range Percent Splice Strand
CG9795-RE 104..2211 168..2274 99   Plus
CG9795-RE 1..70 98..167 100 -> Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:28:29 Download gff for FI02065.complete
Subject Subject Range Query Range Percent Splice Strand
CG9795-RE 104..2211 168..2274 99   Plus
CG9795-RE 1..70 98..167 100 -> Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-05 17:16:20 Download gff for FI02065.complete
Subject Subject Range Query Range Percent Splice Strand
CG9795-RD 1..2811 1..2813 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:22:00 Download gff for FI02065.complete
Subject Subject Range Query Range Percent Splice Strand
CG9795-RD 1..2811 1..2813 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:36:01 Download gff for FI02065.complete
Subject Subject Range Query Range Percent Splice Strand
CG9795-RD 8..2818 1..2813 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:28:29 Download gff for FI02065.complete
Subject Subject Range Query Range Percent Splice Strand
CG9795-RD 8..2818 1..2813 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:28:29 Download gff for FI02065.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4325697..4326372 2136..2813 99   Plus
3R 4324873..4325489 1519..2135 100 -> Plus
3R 4324730..4324811 1437..1518 100 -> Plus
3R 4324588..4324672 1352..1436 100 -> Plus
3R 4324337..4324510 1178..1351 100 -> Plus
3R 4323953..4324164 966..1177 100 -> Plus
3R 4323687..4323889 763..965 100 -> Plus
3R 4323231..4323622 371..762 100 -> Plus
3R 4321845..4322047 168..370 100 -> Plus
3R 4319690..4319856 1..167 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:36:01 Download gff for FI02065.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 151419..152094 2136..2813 99   Plus
arm_3R 150595..151211 1519..2135 100 -> Plus
arm_3R 150452..150533 1437..1518 100 -> Plus
arm_3R 150310..150394 1352..1436 100 -> Plus
arm_3R 150059..150232 1178..1351 100 -> Plus
arm_3R 149675..149886 966..1177 100 -> Plus
arm_3R 149409..149611 763..965 100 -> Plus
arm_3R 148953..149344 371..762 100 -> Plus
arm_3R 147567..147769 168..370 100 -> Plus
arm_3R 145412..145578 1..167 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:10:02 Download gff for FI02065.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4066528..4067203 2136..2813 99   Plus
3R 4065704..4066320 1519..2135 100 -> Plus
3R 4065561..4065642 1437..1518 100 -> Plus
3R 4065419..4065503 1352..1436 100 -> Plus
3R 4065168..4065341 1178..1351 100 -> Plus
3R 4064784..4064995 966..1177 100 -> Plus
3R 4064518..4064720 763..965 100 -> Plus
3R 4064062..4064453 371..762 100 -> Plus
3R 4062676..4062878 168..370 100 -> Plus
3R 4060521..4060687 1..167 100 -> Plus

FI02065.pep Sequence

Translation from 174 to 2273

> FI02065.pep
MSVLREETTTSSQREISTNGGGLDFPAEVTSLIAGNSFCLTPGNNGGIGA
QKKVTTGAGLNSTQRATDATKRKKLRSRNVPPSPLAQKTEAAATSLNQTN
IGEVKRTDINYSNDHLDAWLESCLRDATNAQLSSSSEFLDFIPPTAPAHK
QMFLTQQQQLPQLKQQLQQQRQQEFSKRTQPYGVGPGTPFSLGIQRNSNS
LSHRYPMLFPPQSLNSYGDGGQEFASLPPLNNMMGGPEGLGCDQEPNSTD
VLDGSESNPNFTKGFRFSDPCLLNPSDNDSKLSGQNTPECRNVNNNGSGC
DLAHQNKFFAALMEQINILHDTNSKICRNLHNTKVDIEALKHSPNSQHWA
GVGFGGMRHRRDSLSGLSTQSQPLILGSGLGGTHSPAPTFHSGAYTPGMM
TDVVREVKEAARIREDALLSRVKLMVEERQCSLNEGNVRILRDIDDLKTQ
VMQLRLEKKETNKRLSHLESENKCLRQALAGCYNQRPISNDIIYENDRSH
GFRKPFPNGGGGGVVGSGALGIRRAKSLNLHYGTMHQTPIQTTHSLEEDD
EIEEEQLVEQVGLDGEELSLTGNNSLSCLNIGHQSPSNLTPHSQIPKSEK
QAVRSPPSFALASDQINPGIPPPLLPRKKDHAHLKRERSEAASVRKETNQ
RIIALEKLVEDLSDQVRGKTKRNPTVSSTAADITLSSKFSVADAPITDL*

FI02065.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18204-PA 671 GF18204-PA 2..671 9..699 2004 63.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12296-PA 676 GG12296-PA 21..668 1..644 2666 85.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21262-PA 725 GH21262-PA 2..725 9..699 1752 56.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9795-PE 736 CG9795-PE 38..736 1..699 3638 100 Plus
CG9795-PD 699 CG9795-PD 1..699 1..699 3638 100 Plus
CG9795-PF 693 CG9795-PF 38..691 1..654 3422 100 Plus
CG9795-PA 501 CG9795-PA 1..493 152..644 2603 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10489-PA 744 GI10489-PA 2..744 8..699 1748 56.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12318-PA 733 GL12318-PA 8..733 15..699 1942 63.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22041-PA 738 GA22041-PA 8..738 15..699 1954 63 Plus
Dpse\GA22041-PB 593 GA22041-PB 17..585 107..644 1725 69.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10745-PA 694 GM10745-PA 38..686 1..644 2931 92.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19717-PA 475 GD19717-PA 38..376 1..334 1557 92.6 Plus
Dsim\GD19717-PA 475 GD19717-PA 374..467 551..644 408 86.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23169-PA 721 GJ23169-PA 58..721 55..699 1721 59.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11442-PA 722 GK11442-PA 49..722 60..699 1764 60.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25407-PA 702 GE25407-PA 13..702 2..699 2630 78.4 Plus

FI02065.hyp Sequence

Translation from 174 to 2273

> FI02065.hyp
MSVLREETTTSSQREISTNGGGLDFPAEVTSLIAGNSFCLTPGNNGGIGA
QKKVTTGAGLNSTQRATDATKRKKLRSRNVPPSPLAQKTEAAATSLNQTN
IGEVKRTDINYSNDHLDAWLESCLRDATNAQLSSSSEFLDFIPPTAPAHK
QMFLTQQQQLPQLKQQLQQQRQQEFSKRTQPYGVGPGTPFSLGIQRNSNS
LSHRYPMLFPPQSLNSYGDGGQEFASLPPLNNMMGGPEGLGCDQEPNSTD
VLDGSESNPNFTKGFRFSDPCLLNPSDNDSKLSGQNTPECRNVNNNGSGC
DLAHQNKFFAALMEQINILHDTNSKICRNLHNTKVDIEALKHSPNSQHWA
GVGFGGMRHRRDSLSGLSTQSQPLILGSGLGGTHSPAPTFHSGAYTPGMM
TDVVREVKEAARIREDALLSRVKLMVEERQCSLNEGNVRILRDIDDLKTQ
VMQLRLEKKETNKRLSHLESENKCLRQALAGCYNQRPISNDIIYENDRSH
GFRKPFPNGGGGGVVGSGALGIRRAKSLNLHYGTMHQTPIQTTHSLEEDD
EIEEEQLVEQVGLDGEELSLTGNNSLSCLNIGHQSPSNLTPHSQIPKSEK
QAVRSPPSFALASDQINPGIPPPLLPRKKDHAHLKRERSEAASVRKETNQ
RIIALEKLVEDLSDQVRGKTKRNPTVSSTAADITLSSKFSVADAPITDL*

FI02065.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG9795-PE 736 CG9795-PE 38..736 1..699 3638 100 Plus
CG9795-PD 699 CG9795-PD 1..699 1..699 3638 100 Plus
CG9795-PF 693 CG9795-PF 38..691 1..654 3422 100 Plus
CG9795-PA 501 CG9795-PA 1..493 152..644 2603 100 Plus