Clone FI02066 Report

Search the DGRC for FI02066

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:20
Well:66
Vector:pFlc-1
Associated Gene/TranscriptPk92B-RC
Protein status:FI02066.pep: gold
Sequenced Size:4611

Clone Sequence Records

FI02066.complete Sequence

4611 bp assembled on 2009-01-14

GenBank Submission: BT057977.1

> FI02066.complete
AAAAACAAAAAGTTTCTTTATTTATTTGATAATTATTCGTTACGCGGTAA
TTAACGCGATGCAAGTGCAGCAGGAACGTGGTAATGAGAGTTTTTGCCAC
TGAGCTGCGCGTGTCGGCCGTCCAGAAAGTGCAGAAATCGCGTGAGGTGC
GCGAAATCCGTCCAAGAGCAGAAAAGTGCCAAGAATAGCTGCGATGGAAA
CAGCGATGGATGTGGTGTGTGTAATGGATACGGCGGTGGGCGACCATCTG
GAGGACCGCCAGTGTGCGCTGGAGGAGATCAAGCAGGCAGTGCAGTCGGC
GGGCGCCAACTTTCAGCGGGTTCAGTTCGAGCGCCTGGACTTCGGCGAGA
CGAATGTGCTGGAGACGTTTTACAACGCCGATGTGGCCATTATCGACCTG
AGCATTCTCACCCAGCAGCGGCCGCTTTCCTATCACTACGGCGTTAGGGA
GAGCTTCGGGATGAAGGAGAACATCCTCACCTACAACGACATCGATTCCA
AGCAGACGCTCAGTCTCAAGCTCTCGTGTGCCAACTACCTGTTTCTCAGC
TACAAGCGGAATGCGGAGACCAATTCCTGCCACCTGACCAGCCAGCCCAA
CAGCGGCAACAACAGCAAGGAACCCAATGCCGAAGGACGAGTGCCCACTT
TGCAGTGGCGCCTCAAGCGAAAGCTGCAAGATGTTGAGATCCAGTCGAAA
GCCCACATGCGTGAGAAATTTCTGAGTGACATGCGAACGGCGCGGGACAC
GTACGCCACCAACGGCGCCAAGCTGCAGAGTATATTGCACGAGATGCGAA
AGCGGCTGGACGATCCGCATGTCCTGTCTGGCGAAGTGGTACACAGTTTC
ATGTGCTCGCTGAGGGATGTGCAGGACTACGATGCCATGGTGCGACTGGT
CAATGACCTGAAGAACATACCCAACACCCGGAAGTACGTGGAGACGGGCA
ACATGAGTTTCCTGTACGCCTTCGCCCTGAACCGAAGAAATCGAAAGGGA
GACCGTGAAAAGGCTCTGGAATCTTCGCTGAAGGCGCTGGAAAAGAAGGA
GAACCACTTTCCGGACATGCTCTGCCTGTGCGGCCGCATCTACAAGGACA
TCTTTGTGGAATCCGACTACACGGACGCCACCAGTTTGGCGCACGCCATC
AAGTGGTACCGCCAAAGCTTTGAGGTGCAGCCGAATGAGTATGCAGGCAT
CAATCTGGCTACTCTGCTGGTTATCGAGGGCAAGGAGTTTACCAATACGG
AGGAGTTGCAGCACATCGGCATGACCTTAAACAATTTAATCGGTAAAAAG
GGCAGCCTATCCTCGCTGAGTGAGTATTGGGATGTGGCCACCTTCTTTGA
GATCTCCGTTTTGGCCAACGACTACGCCAAGGCGATTCAAGCTGCCGAGT
GCATGTTCAAGCTAAAGCCACCCAACTGGTATCTGAAGTCGACCATCGGA
AATATCTCTCTTATACATCGATTTCGAAAGAAGCCCGAGGAACGCCAGCC
GCCCATCGAGGAGCAGGTGTTCCAGTTCTGGATGGACTTCTTTCTGGAGG
CCACCAACACCGAGGAGGTTAAGAACAGCATTCGCTTTCCGATTCTGATC
CTCGAGCCTCAGAAGATTTATATGCCCAGTTATGTGACTATAAACATGGA
TGCGGATGAGAAGTCCATTCAGATTGTGAACATCTGTTTGGCTCACGCAA
AGAATGCGTGTAAGAAAATCCACGACTTCCTTTTCGTGGCATCGAAGATC
AAGTCCGTCAGCCTTTACAAGAGGGATGATCGTTGTGCCTACTTGTACGT
CCATCACAACTCAGATGATTTTCAAATATATTTTCCCTCCACTGAACGAC
GACAAAAGTTCTACGATATGATCCTGGAGATGACTGCAGATCAGGTGGTG
TTTGTCAATCTCAGCAATGATGACGCTAATATCGAGTACGAGTACGACTA
CGATGAGCAGAATCGCAAAATGGTGCTGGGCAAAGGTACTTATGGCACCG
TGTACGCCGCCAGGGACAAGCAGACGCAGGTGCGAATCGCCATTAAGGAG
GTGCCGGAAAAGAACTCGCAGGATGTGCAGCCACTGCACGAGGAGATTAA
GTTACACTCTCAGCTGCGACATCGCAACATAGTTCGCTATTTGGGATCGT
GTTCGGAGAACGGCTTCTTCAAGATCTTCATGGAGCAGGTGCCGGGAGGA
TCGCTTTCCGACCTCTTAGAGACCAAATGGGGTCCGCTCAAGGACAACGA
GTCCACCATGGCCTTCTACTCCAAGCAGATCCTCGAGGGGCTGAAGTACC
TTCACGAGCAGGACATTGTTCATCGCGATATAAAGGGTGACAACGTGCTG
GTTAACACGTATAGCGGCGTGGTTAAGATCTCCGATTTCGGCACCTCCAA
GCGGCTGGCCCGCATCAACCCGATGACGGAGACCTTTACGGGCACCTTGC
AGTACATGGCGCCGGAGGTGATTGACCAGGGAGTACGCGGCTATGGCCCG
GCGGCTGACATCTGGTCCTTTGGATGCACAAACGTTGAGATGGCTACGGG
CAAACCACCGTTTATCGAGCTGGGTAGCGCCCATGCGGCCATGTTCAAGG
TGGGCTTTTACAAGAAGCATCCGAACATACCCGAGGAGCTGTCCGCCAAC
GCAAAGAACTTTATTTTGCGTTGCTTTGCCATCAGCGTGATGGACCGACC
CTCCGCCTCGCAACTTCTGGAAGATCCCTTCCTACAAGATAAACCCCGCA
AGGTGCGCCCAGCCCTGCCCATCAATACTGAGTTCGGACGCAGCATTTCG
GTGCCGGCTGATCGGTTTGTGCACAAAACCACACCGCCGCTGAGCTACAA
CACAACCTGCAATACGCCCACAACGCCGGAATTGGACATAACGCATTCAT
CCTCGGTGGACATTGACGAGCTGCCCAGCAACCAGTTTATGCTTGAACGG
CGAAATTCCCATGGATTTTTGCTCTCGCCAGAGATTGAACCTTCCACGCC
GTCCTTGCGTACGAGCATTAGTGAGACGAGCGAGACTGACGGTTTTTACA
GGCTTAAAAAGGATTCGCAGAGGCGGACAACGCTTTCCAAGGTGCTGGCA
CTAGACGAATCCAAGATCTGCGATATTTGGCTGAAGAAGGTCGACGCTGA
TCAGAACTCGATTGCGATTAGGAAAAGCGATTTGGAGGTTCTAATCCGAG
GACTGCGGGACTACATTATGAACGAAAACGAAAAGCATTTGGAAGCGACT
ATCAACGAACTGAAACAAAAGCTGAACAACGACGCAGTTGCTCTGGACCA
TCTTCATTTGGCGCTGTACTCCTTTCAGGACGCCGTGGTCTGCGTACTGC
GGTACCATTGCATCAAACCCCATTGGATGTTCGCATTGGATAATCTGGTT
AAGCGGGCCGTCCAGGCGGCGGTCACTATTTTCTCTCCTGAACTGGGCGC
CAATCTGGCGGACAAAGACCTGTCTGGAAATGATGATGAGAGCTTGCGTA
CAAGTCTAATGCAGAAGGGTTCCACCGAGAGCCAGGAAAAGCAGAGCCTG
GAAAAAGTTCTTCCCACGAGCAACACTCGCGAAGGTGTGGGATTAACGCC
TGCGGAATCGGGCGGGGATGCTCTGTCCAGTTCGATGGAGTGCGCGCGCA
TCCTGAGAGACATCCGTGACAATCAGCAGAAGCTGCAACGCCAGCTCCTT
GAGCAGCAGCGGCAGAGCATGAGGGCCCTGCATAATATCAGTCAGGAGCT
GGCTCACATTTACATGGGCGGCAGAAAGAGATTAAGACGCACAATAAACG
GCTTTAACAAAAAGTGCCATAGAATGAGTACCAGTGTGGGCGGAACGTCC
GGAGTCCGTCCGAATATAGCGGGCAATCCCCGGAGGCAGCTAAACAAGCA
TCACTTTGGTCTTCACGAAGTAGACGAGCAGTTGGAGCAGTGGTTGACCC
AGCAGGAAATAGACGAGTTCTCAAAGACGCTCATCCTGAATGAAGGTTTT
ACATTTGACGACTTTATCTATAACATGGAAAAGCTGGACCTCATGAGGCT
GGGTCTGCGCGTTGGCATCGAAGTGCGTTTGTGGAAACTCATTATACAAG
AACGTGTGTGCACCTCGTCCGATTGTGTGGACAGTCCACCAAGCACTTAC
CACAAACCCATTGGAGGCAATAGCTCTTTTGCGCTTATTGACAACAACAA
TACGCTACCATCACCCACAACCACAACTCCCGGAACGCCGGGCATCAAAA
CGAAAATCAAGAAAAGCGAAAGCGAGTACGATTCGTGCAGCGAGTGACTG
TAGTTGAAAGCTTTCTGAGTTGTGCCTTTACAGATACTACTGATTAATTG
TTAATGTTCTCCATGTGCTACTAACCGCTGCGAGGCTCAGCTCAATGAGT
CTCCAGCAGCCCTGGGTTAAGTTCTCCCATGCTGGCTCATGTCTTTTCAA
CTTTGAGTTCGAAAAGGCGTTGTCTGTGTGTCCAGTTTTAACGATTGCAT
GTTAACTTATAAAAATGGAATTTACATAAGTGCCTTTAATTTAAAAAAAA
AAGAAAACAAAAACTGAAATAGATAATATATTGTGAAGTGCTTTGCAAAA
AAAAAAAAAAA

FI02066.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
Pk92B-RC 4700 Pk92B-RC 98..4699 1..4602 22935 99.8 Plus
Pk92B.a 4700 Pk92B.a 98..4699 1..4602 22935 99.8 Plus
Pk92B-RB 5194 Pk92B-RB 1111..5194 519..4602 20375 99.9 Plus
Pk92B-RB 5194 Pk92B-RB 21..540 1..520 2570 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15708124..15709023 2887..3786 4500 100 Plus
chr3R 27901430 chr3R 15705410..15706307 700..1597 4400 99.3 Plus
chr3R 27901430 chr3R 15706767..15707571 1935..2739 3980 99.6 Plus
chr3R 27901430 chr3R 15709421..15709958 4059..4596 2660 99.6 Plus
chr3R 27901430 chr3R 15706363..15706702 1597..1936 1700 100 Plus
chr3R 27901430 chr3R 15703646..15703970 1..325 1595 99.4 Plus
chr3R 27901430 chr3R 15709082..15709356 3785..4059 1345 99.3 Plus
chr3R 27901430 chr3R 15704040..15704237 323..520 990 100 Plus
chr3R 27901430 chr3R 15704808..15704988 519..699 890 99.4 Plus
chr3R 27901430 chr3R 15707635..15707781 2740..2886 735 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
Pk92B-RC 4092 CG4720-PC 1..4092 206..4297 20445 100 Plus
Pk92B-RB 3591 CG4720-PB 1..3591 707..4297 17940 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:07:40 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
Pk92B-RC 4596 CG4720-RC 1..4596 1..4596 22905 99.9 Plus
Pk92B-RB 5168 CG4720-RB 1091..5168 519..4596 20345 99.9 Plus
Pk92B-RB 5168 CG4720-RB 1..520 1..520 2570 99.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
Pk92B-PC 1363 CG4720-PC 1..1363 206..4294 6761 100 Plus
Pk92B-PB 1196 CG4720-PB 1..1196 707..4294 5896 100 Plus
hppy-PE 934 CG7097-PE 24..284 1952..2737 387 37.4 Plus
hppy-PB 947 CG7097-PB 24..284 1952..2737 387 37.4 Plus
hppy-PC 968 CG7097-PC 24..284 1952..2737 387 37.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19884196..19885095 2887..3786 4500 100 Plus
3R 32079331 3R 19881484..19882381 700..1597 4490 100 Plus
3R 32079331 3R 19882841..19883645 1935..2739 4010 99.9 Plus
3R 32079331 3R 19885493..19886036 4059..4602 2690 99.6 Plus
3R 32079331 3R 19882437..19882776 1597..1936 1700 100 Plus
3R 32079331 3R 19879719..19880043 1..325 1595 99.4 Plus
3R 32079331 3R 19885154..19885428 3785..4059 1375 100 Plus
3R 32079331 3R 19880113..19880310 323..520 990 100 Plus
3R 32079331 3R 19880881..19881061 519..699 905 100 Plus
3R 32079331 3R 19883709..19883855 2740..2886 735 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19625027..19625926 2887..3786 4500 100 Plus
3R 31820162 3R 19622315..19623212 700..1597 4490 100 Plus
3R 31820162 3R 19623672..19624476 1935..2739 4010 99.8 Plus
3R 31820162 3R 19626324..19626867 4059..4602 2690 99.6 Plus
3R 31820162 3R 19623268..19623607 1597..1936 1700 100 Plus
3R 31820162 3R 19620550..19620874 1..325 1595 99.3 Plus
3R 31820162 3R 19625985..19626259 3785..4059 1375 100 Plus
3R 31820162 3R 19620944..19621141 323..520 990 100 Plus
3R 31820162 3R 19621712..19621892 519..699 905 100 Plus
3R 31820162 3R 19624540..19624686 2740..2886 735 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:44:44 has no hits.

FI02066.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:42:43 Download gff for FI02066.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15709422..15709958 4060..4596 99   Plus
chr3R 15709084..15709356 3787..4059 99 -> Plus
chr3R 15708124..15709023 2887..3786 100 -> Plus
chr3R 15707635..15707781 2740..2886 100 -> Plus
chr3R 15706769..15707571 1937..2739 99 -> Plus
chr3R 15706364..15706702 1598..1936 100 -> Plus
chr3R 15705410..15706307 700..1597 99 -> Plus
chr3R 15704810..15704988 521..699 99 -> Plus
chr3R 15704043..15704237 326..520 100 -> Plus
chr3R 15703646..15703970 1..325 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:58:56 Download gff for FI02066.complete
Subject Subject Range Query Range Percent Splice Strand
Pk92B-RC 1..4092 206..4297 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:28:17 Download gff for FI02066.complete
Subject Subject Range Query Range Percent Splice Strand
Pk92B-RC 1..4092 206..4297 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:36:41 Download gff for FI02066.complete
Subject Subject Range Query Range Percent Splice Strand
Pk92B-RC 1..4092 206..4297 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:42:43 Download gff for FI02066.complete
Subject Subject Range Query Range Percent Splice Strand
Pk92B-RC 1..4092 206..4297 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-14 17:47:51 Download gff for FI02066.complete
Subject Subject Range Query Range Percent Splice Strand
Pk92B-RC 1..4596 2..4596 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:28:17 Download gff for FI02066.complete
Subject Subject Range Query Range Percent Splice Strand
Pk92B-RC 1..4596 2..4596 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:36:41 Download gff for FI02066.complete
Subject Subject Range Query Range Percent Splice Strand
Pk92B-RC 1..4596 2..4596 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:42:43 Download gff for FI02066.complete
Subject Subject Range Query Range Percent Splice Strand
Pk92B-RC 1..4596 2..4596 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:42:43 Download gff for FI02066.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19885494..19886030 4060..4596 99   Plus
3R 19885156..19885428 3787..4059 100 -> Plus
3R 19884196..19885095 2887..3786 100 -> Plus
3R 19883709..19883855 2740..2886 100 -> Plus
3R 19882843..19883645 1937..2739 99 -> Plus
3R 19882438..19882776 1598..1936 100 -> Plus
3R 19881484..19882381 700..1597 100 -> Plus
3R 19880883..19881061 521..699 100 -> Plus
3R 19880116..19880310 326..520 100 -> Plus
3R 19879719..19880043 1..325 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:36:41 Download gff for FI02066.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15711216..15711752 4060..4596 99   Plus
arm_3R 15710878..15711150 3787..4059 100 -> Plus
arm_3R 15709918..15710817 2887..3786 100 -> Plus
arm_3R 15709431..15709577 2740..2886 100 -> Plus
arm_3R 15708565..15709367 1937..2739 99 -> Plus
arm_3R 15708160..15708498 1598..1936 100 -> Plus
arm_3R 15707206..15708103 700..1597 100 -> Plus
arm_3R 15706605..15706783 521..699 100 -> Plus
arm_3R 15705838..15706032 326..520 100 -> Plus
arm_3R 15705441..15705765 1..325 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:01:02 Download gff for FI02066.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19626325..19626861 4060..4596 99   Plus
3R 19625987..19626259 3787..4059 100 -> Plus
3R 19625027..19625926 2887..3786 100 -> Plus
3R 19624540..19624686 2740..2886 100 -> Plus
3R 19623674..19624476 1937..2739 99 -> Plus
3R 19623269..19623607 1598..1936 100 -> Plus
3R 19622315..19623212 700..1597 100 -> Plus
3R 19621714..19621892 521..699 100 -> Plus
3R 19620947..19621141 326..520 100 -> Plus
3R 19620550..19620874 1..325 99 -> Plus

FI02066.pep Sequence

Translation from 193 to 4296

> FI02066.pep
METAMDVVCVMDTAVGDHLEDRQCALEEIKQAVQSAGANFQRVQFERLDF
GETNVLETFYNADVAIIDLSILTQQRPLSYHYGVRESFGMKENILTYNDI
DSKQTLSLKLSCANYLFLSYKRNAETNSCHLTSQPNSGNNSKEPNAEGRV
PTLQWRLKRKLQDVEIQSKAHMREKFLSDMRTARDTYATNGAKLQSILHE
MRKRLDDPHVLSGEVVHSFMCSLRDVQDYDAMVRLVNDLKNIPNTRKYVE
TGNMSFLYAFALNRRNRKGDREKALESSLKALEKKENHFPDMLCLCGRIY
KDIFVESDYTDATSLAHAIKWYRQSFEVQPNEYAGINLATLLVIEGKEFT
NTEELQHIGMTLNNLIGKKGSLSSLSEYWDVATFFEISVLANDYAKAIQA
AECMFKLKPPNWYLKSTIGNISLIHRFRKKPEERQPPIEEQVFQFWMDFF
LEATNTEEVKNSIRFPILILEPQKIYMPSYVTINMDADEKSIQIVNICLA
HAKNACKKIHDFLFVASKIKSVSLYKRDDRCAYLYVHHNSDDFQIYFPST
ERRQKFYDMILEMTADQVVFVNLSNDDANIEYEYDYDEQNRKMVLGKGTY
GTVYAARDKQTQVRIAIKEVPEKNSQDVQPLHEEIKLHSQLRHRNIVRYL
GSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGL
KYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTETFTG
TLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAM
FKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFLQDK
PRKVRPALPINTEFGRSISVPADRFVHKTTPPLSYNTTCNTPTTPELDIT
HSSSVDIDELPSNQFMLERRNSHGFLLSPEIEPSTPSLRTSISETSETDG
FYRLKKDSQRRTTLSKVLALDESKICDIWLKKVDADQNSIAIRKSDLEVL
IRGLRDYIMNENEKHLEATINELKQKLNNDAVALDHLHLALYSFQDAVVC
VLRYHCIKPHWMFALDNLVKRAVQAAVTIFSPELGANLADKDLSGNDDES
LRTSLMQKGSTESQEKQSLEKVLPTSNTREGVGLTPAESGGDALSSSMEC
ARILRDIRDNQQKLQRQLLEQQRQSMRALHNISQELAHIYMGGRKRLRRT
INGFNKKCHRMSTSVGGTSGVRPNIAGNPRRQLNKHHFGLHEVDEQLEQW
LTQQEIDEFSKTLILNEGFTFDDFIYNMEKLDLMRLGLRVGIEVRLWKLI
IQERVCTSSDCVDSPPSTYHKPIGGNSSFALIDNNNTLPSPTTTTPGTPG
IKTKIKKSESEYDSCSE*

FI02066.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 17:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17624-PA 1357 GF17624-PA 1..1357 5..1367 6600 90.8 Plus
Dana\GF17866-PA 1573 GF17866-PA 1287..1547 590..848 389 35.7 Plus
Dana\GF13179-PA 654 GF13179-PA 35..293 595..858 370 36.3 Plus
Dana\GF11577-PA 1271 GF11577-PA 24..284 587..848 370 37.4 Plus
Dana\GF18356-PA 718 GF18356-PA 439..696 588..848 364 34 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 17:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Pk92B-PA 1361 GG23570-PA 1..1361 5..1367 7041 97.1 Plus
Dere\GG16341-PA 1613 GG16341-PA 1288..1585 558..848 383 34.3 Plus
Dere\GG21950-PA 1240 GG21950-PA 24..284 587..848 371 37.4 Plus
Dere\GG20903-PA 666 GG20903-PA 48..306 595..858 370 36.3 Plus
Dere\GG21995-PA 640 GG21995-PA 7..264 580..848 354 35 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 17:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16508-PA 1352 GH16508-PA 1..1352 5..1367 5922 82.4 Plus
Dgri\GH23090-PA 986 GH23090-PA 16..287 578..850 391 36.2 Plus
Dgri\GH22076-PA 1574 GH22076-PA 1287..1547 590..848 389 35.5 Plus
Dgri\GH13884-PA 838 GH13884-PA 551..811 590..848 387 35.7 Plus
Dgri\GH22772-PA 691 GH22772-PA 34..281 595..849 361 36.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 17:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
Pk92B-PC 1363 CG4720-PC 1..1363 5..1367 7096 100 Plus
Pk92B-PB 1196 CG4720-PB 1..1196 172..1367 6231 100 Plus
hppy-PE 934 CG7097-PE 24..284 587..848 387 37.4 Plus
hppy-PB 947 CG7097-PB 24..284 587..848 387 37.4 Plus
hppy-PC 968 CG7097-PC 24..284 587..848 387 37.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 17:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22433-PA 1337 GI22433-PA 1..1337 5..1367 5866 81.3 Plus
Dmoj\GI18916-PA 976 GI18916-PA 21..286 579..850 391 36.4 Plus
Dmoj\GI21956-PA 1588 GI21956-PA 1279..1559 567..846 377 35.3 Plus
Dmoj\GI20569-PA 672 GI20569-PA 33..280 595..849 364 36.6 Plus
Dmoj\GI10198-PA 402 GI10198-PA 132..380 595..849 361 33.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 17:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12207-PA 941 GL12207-PA 1..939 5..951 4629 91.4 Plus
Dper\GL12208-PA 348 GL12208-PA 8..348 1028..1367 1343 79.3 Plus
Dper\GL23109-PA 1572 GL23109-PA 1264..1546 567..848 389 34.6 Plus
Dper\GL21741-PA 547 GL21741-PA 279..525 595..848 373 34.2 Plus
Dper\GL10521-PA 661 GL10521-PA 31..278 595..849 362 36.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 17:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Pk92B-PA 1357 GA18383-PA 1..1357 5..1367 6392 88.8 Plus
Dpse\Pk92B-PB 1194 GA18383-PB 1..1194 172..1367 5677 90.1 Plus
Dpse\GA20540-PB 1502 GA20540-PB 1194..1476 567..848 389 34.4 Plus
Dpse\GA20540-PA 1574 GA20540-PA 1266..1548 567..848 389 34.6 Plus
Dpse\GA20098-PC 942 GA20098-PC 24..284 587..848 370 37 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 17:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26871-PA 1367 GM26871-PA 1..1367 1..1367 7394 99.6 Plus
Dsec\GM16093-PA 169 GM16093-PA 1..169 1..169 907 99.4 Plus
Dsec\GM18685-PA 1621 GM18685-PA 1311..1593 567..848 389 35.1 Plus
Dsec\GM16553-PA 505 GM16553-PA 209..501 567..859 387 34.9 Plus
Dsec\GM19825-PA 668 GM19825-PA 48..306 595..858 371 36.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 17:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19320-PA 1336 GD19320-PA 1..1336 1..1367 6959 97.4 Plus
Dsim\GD20154-PA 1621 GD20154-PA 1311..1593 567..848 389 35.1 Plus
Dsim\GD25317-PA 668 GD25317-PA 48..306 595..858 372 36.2 Plus
Dsim\GD11434-PA 1165 GD11434-PA 24..284 587..848 368 37.4 Plus
Dsim\GD19869-PA 701 GD19869-PA 422..679 588..848 359 33.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 17:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10996-PA 1344 GJ10996-PA 1..1344 5..1367 5989 83.5 Plus
Dvir\GJ19771-PA 1037 GJ19771-PA 24..286 587..850 390 36.7 Plus
Dvir\GJ14314-PA 1564 GJ14314-PA 1255..1535 567..846 387 35.3 Plus
Dvir\GJ21419-PA 681 GJ21419-PA 33..280 595..849 364 36.7 Plus
Dvir\GJ23486-PA 401 GJ23486-PA 131..379 595..849 357 32.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 17:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\Pk92B-PA 1380 GK22362-PA 1..1380 5..1367 6394 88.1 Plus
Dwil\GK13548-PA 1563 GK13548-PA 1255..1537 567..848 395 34.7 Plus
Dwil\GK20667-PA 1300 GK20667-PA 24..284 587..848 368 37 Plus
Dwil\GK12175-PA 722 GK12175-PA 443..700 588..848 364 34 Plus
Dwil\GK15703-PA 636 GK15703-PA 27..285 595..858 357 35.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 17:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25632-PA 1363 GE25632-PA 1..1363 5..1367 7010 97.8 Plus
Dyak\GE25175-PA 1613 GE25175-PA 1303..1585 567..848 392 35.1 Plus
Dyak\GE13841-PA 672 GE13841-PA 48..306 595..858 370 36.3 Plus
Dyak\GE12024-PA 1248 GE12024-PA 24..284 587..848 369 37.4 Plus
Dyak\GE10214-PA 704 GE10214-PA 425..682 588..848 359 33.6 Plus

FI02066.hyp Sequence

Translation from 193 to 4296

> FI02066.hyp
METAMDVVCVMDTAVGDHLEDRQCALEEIKQAVQSAGANFQRVQFERLDF
GETNVLETFYNADVAIIDLSILTQQRPLSYHYGVRESFGMKENILTYNDI
DSKQTLSLKLSCANYLFLSYKRNAETNSCHLTSQPNSGNNSKEPNAEGRV
PTLQWRLKRKLQDVEIQSKAHMREKFLSDMRTARDTYATNGAKLQSILHE
MRKRLDDPHVLSGEVVHSFMCSLRDVQDYDAMVRLVNDLKNIPNTRKYVE
TGNMSFLYAFALNRRNRKGDREKALESSLKALEKKENHFPDMLCLCGRIY
KDIFVESDYTDATSLAHAIKWYRQSFEVQPNEYAGINLATLLVIEGKEFT
NTEELQHIGMTLNNLIGKKGSLSSLSEYWDVATFFEISVLANDYAKAIQA
AECMFKLKPPNWYLKSTIGNISLIHRFRKKPEERQPPIEEQVFQFWMDFF
LEATNTEEVKNSIRFPILILEPQKIYMPSYVTINMDADEKSIQIVNICLA
HAKNACKKIHDFLFVASKIKSVSLYKRDDRCAYLYVHHNSDDFQIYFPST
ERRQKFYDMILEMTADQVVFVNLSNDDANIEYEYDYDEQNRKMVLGKGTY
GTVYAARDKQTQVRIAIKEVPEKNSQDVQPLHEEIKLHSQLRHRNIVRYL
GSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGL
KYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRLARINPMTETFTG
TLQYMAPEVIDQGVRGYGPAADIWSFGCTNVEMATGKPPFIELGSAHAAM
FKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQLLEDPFLQDK
PRKVRPALPINTEFGRSISVPADRFVHKTTPPLSYNTTCNTPTTPELDIT
HSSSVDIDELPSNQFMLERRNSHGFLLSPEIEPSTPSLRTSISETSETDG
FYRLKKDSQRRTTLSKVLALDESKICDIWLKKVDADQNSIAIRKSDLEVL
IRGLRDYIMNENEKHLEATINELKQKLNNDAVALDHLHLALYSFQDAVVC
VLRYHCIKPHWMFALDNLVKRAVQAAVTIFSPELGANLADKDLSGNDDES
LRTSLMQKGSTESQEKQSLEKVLPTSNTREGVGLTPAESGGDALSSSMEC
ARILRDIRDNQQKLQRQLLEQQRQSMRALHNISQELAHIYMGGRKRLRRT
INGFNKKCHRMSTSVGGTSGVRPNIAGNPRRQLNKHHFGLHEVDEQLEQW
LTQQEIDEFSKTLILNEGFTFDDFIYNMEKLDLMRLGLRVGIEVRLWKLI
IQERVCTSSDCVDSPPSTYHKPIGGNSSFALIDNNNTLPSPTTTTPGTPG
IKTKIKKSESEYDSCSE*

FI02066.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Pk92B-PC 1363 CG4720-PC 1..1363 5..1367 7096 100 Plus
Pk92B-PB 1196 CG4720-PB 1..1196 172..1367 6231 100 Plus
hppy-PE 934 CG7097-PE 24..284 587..848 387 37.4 Plus
hppy-PB 947 CG7097-PB 24..284 587..848 387 37.4 Plus
hppy-PC 968 CG7097-PC 24..284 587..848 387 37.4 Plus