Clone FI02074 Report

Search the DGRC for FI02074

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:20
Well:74
Vector:pFlc-1
Associated Gene/TranscriptCG32091-RB
Protein status:FI02074.pep: gold
Sequenced Size:2979

Clone Sequence Records

FI02074.complete Sequence

2979 bp assembled on 2008-12-22

GenBank Submission: BT056236.1

> FI02074.complete
GACATTTGGGGAACCCGTTGGACTGCGACTCCAAGTGCCGACTAAGCGTC
AGTTCAGTTGTTTTCACGCCGCCGTTGAGAGTGGACGCGGTTTTGCCAGC
TCTTCAAAAATTTAAGTTCGCGTCGCTTTTTCCTCGGCCAATTTCAGCAC
ATTTTTCGCGGGGAAATTTGAAACGCATTACATAAGCCAAGCCAATCGCG
TAAGACGCCAGTGCGATCAAAACAAAACGGGTAATAAATCTGCAATCACA
CGGCCATGCGTGCATAAAGAGGAACAATAACAAAATCAAAAGTCAGAAGA
AAAAACAAAATAAAAATATAAAAAAATCACAACAATAATAATCGCGAAGC
TGGCAAAAGTACAACAAAAAAGACAAGAGCAAGTGTAAAATAAATAAATA
AATAACCGCGCGGCAGCCAGCACAGATCCAGCACACATTCCCATTCCCAT
TCCCATTCCAATTCCGACTTTGGTGCGGTAGGTAATGACACATTCGGCAG
CCAGCACACGTATCTAGATGCGAGCGAGCATAGTACGTATCTGAATCCGT
CAGTGAAAAGCCGGGTAGACACCATCGCCATCAGAACCAGCGGAGCCAAC
CCTTGCCACCCACATCGTTCATTAATCTATGAGCTTTTGAAAGCGGCATT
AAAAAACGATAAACAAATTCATTAGAAGTCGCCATGGAACAGTCGCAGAA
CTTACTCGCCAAACAGTCCAAAAATGTGGAGTTCCAAGATGTGTACTACA
CCGTCAAGGAGCGCAAGAATTTCTGGCGCGTAACCGGTGAGCGTCGAATT
CTGAATGGAGTCAGCGGCAGTTTCCGGAATGGTCAACTTTCGGCAATCAT
GGGACCCTCAGGAGCCGGAAAAAGCAGTTTGCTTAATGCGATTTCGGGTT
TCAGACGCGACGGAGTCACTGGGAACATCAAGATGAAGCGGGACAATGCC
TGCTATATCACTCAGGACGACCACCACCAGACCCTGCTGACTGTCGAGGA
GCTTATGAATCTCGCCTGCGATCTCAAGTTAAAGAATCGTCACAAAAAGG
CTGAAATCATGACCGATATATTGGAGAATCTGCACTTGAATCACCGGCGC
AATGTGACGGCAGAGAAGTTGAGTGGCGGGGAGCGTAAGCGATTGTCCAT
CGCCCTGGAGCTGGTGGACAATCCAAACATATTCTTCTTGGACGAACCAA
CCAGTGGCCTGGACGAAGTGACAGCGGCCCAGTGCATCCGTTTGCTGCAG
GCGATGGCATACGAGGGTCGCACCATCGTTTGCACCATCCATCAACCTTC
GGCCACGATATACAACTACTTCGATAGCATCTACGTCCTGGCCAAGGGCC
AATGTGTCTACCAAGGCAGTCCCAGAGCCACCATTCCCTTTCTGCGATTG
GCCCAGCTGGATTGCCCCAGGCATTACAGTCCTTCGGATTATATTATTGA
GCTGGTGGATGCCGAGGATGGACACCTGGTGCCAGCACTCAGCGACCTAA
CCGAAAACGGGAAGCTGATCTATGTGGTCAGTCAGTCTGAGCAATTGGCA
CCTCAGCAGGCGGTCACCACAATGTTTCTGGAGCAACAGAAGCGTCCATT
CTTGCCCGCCTTTTTCGCTGGCAGCGCCGCCTCCACGGATGGAACGCTAA
TTGGAGGCACCAGTGCTCTGTTGGAGCAAGTGAAGGCCTTCTCGAAGAGA
CTCCATACGGATCGGCGGGATGTATGTGGGTTTCGTCAGTTTATCGTTCT
TATGCGAATAATGCTACTGAGAATAACGCGTGCTCGTTTGGCACTGACCA
TCCAATTGTTCCATCACCTGCTGTGCGGTCTGTTCTTTGGCCTGATATTC
TTCCAACTGGGCAACCAAGGTGCCCGGATGTTCGATCATCTGAAATTCTG
CATCGGCGCCGTCCTCATGATCGTGTACACCCAGGTGATGGTGCCCATTT
TGAGCTATCCCGCTGAGGTGAAACTGGTCAAGAAGGAGACCTTTAATCGT
TGGTATACCCTCACCCCGTACTACATGGCCCTCACAGTTTCGCGACTGCC
AGTTCAAGTGCTACTCAACATCACCTTCATGGCTGTCACGTACTGGATGT
CCGGATTGCCGCAGCAGTTCTGGCGCTTCTGCATTTTTGTGGCTGTGGGT
TTGATGATCTCATTGGTGGCCGAGGGAATGGGCCTGGCAATTGGAGCCAC
CTTCAGCATTACGAATGGCAGTGTGGTGGGTCCGATGCTAATAGCTCCTC
TGATGGGTTTGGCCGTCTACGGATTTGACTTTGCGCCGCAGGTATCCGGC
GGAATGCAACTGCTGATGAAATTCAGCTATGTGCGTGTGGGCGTGGTTTC
GTTGGTTTTAGCCGTCTTCGGATTTCAGCGGGAAGAACTCGACTGCGATG
CGATATACTGTCATTTTAGCGATCCTCGCGTGCTGCTCAAATTTTTGGAT
GTGGAAAAGGTGTCGATGCTCCATCAGTTCGGATTGCTGGCCATGCTGAT
GCTGTTCTTCCGAGTGATGATGTACATCAGCCTGCGAAAGCGATGCTATG
CCTGATTTTGAAACCAATATTCCAGATGAATCTTATCCCTAGCTTTAGGC
AATGTCAATGCTGTGATGTTCGATTTTAAACAGACAGATAGATACTTCCT
GTACATACTTATGCACCATTCCCATGAAAAAGAACAAAGGTTAACATAAA
CATAAGATAGCTTAAGTTAGGATATAGTTCACATACACAAATGCCTTTTA
AAAGCCAAATTATTTGCACGGATATAATGCAAACGTTGCGAAGAAATCTT
GAGATTAGCGAAATGTATATTGATAACATTTCGGTTAAAATCTAAATGAT
ACGACAATCCCCAAGTTGTTTGCAAGGAGACGGCTGCACATTTTTTACAT
TTTTTGTGGTTAAAGTAATATCAATTCGAATTGTACAAGAATAAAACCCA
TGTTTTGACGATTCAAAAAAAAAAAAAAA

FI02074.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG32091-RB 2967 CG32091-RB 1..2966 1..2966 14815 99.9 Plus
CG32091.a 2388 CG32091.a 196..2388 774..2966 10965 100 Plus
CG32091.a 2388 CG32091.a 1..200 1..200 985 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11633060..11633817 2213..2964 3570 98.7 Plus
chr3L 24539361 chr3L 11631566..11632110 899..1443 2560 98 Plus
chr3L 24539361 chr3L 11625510..11626091 197..775 2520 96.4 Plus
chr3L 24539361 chr3L 11632176..11632688 1444..1956 2520 99.4 Plus
chr3L 24539361 chr3L 11632748..11633004 1957..2213 1240 98.8 Plus
chr3L 24539361 chr3L 11622311..11622506 1..196 980 100 Plus
chr3L 24539361 chr3L 11630981..11631110 775..904 650 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:30:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG32091-RB 1872 CG32091-PB 1..1872 684..2555 9360 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:07:47 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:30:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG32091-RB 2967 CG32091-RB 4..2967 1..2964 14805 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG32091-PB 623 CG32091-PB 1..623 684..2552 2873 100 Plus
CG31689-PH 624 CG31689-PH 7..316 675..1589 620 41.1 Plus
CG3164-PD 698 CG3164-PD 36..316 696..1514 618 45.6 Plus
CG3164-PB 698 CG3164-PB 36..316 696..1514 618 45.6 Plus
CG3164-PC 699 CG3164-PC 37..317 696..1514 618 45.6 Plus
CG3164-PD 698 CG3164-PD 471..691 1872..2537 325 31.7 Plus
CG3164-PB 698 CG3164-PB 471..691 1872..2537 325 31.7 Plus
CG31689-PH 624 CG31689-PH 414..620 1926..2543 255 26.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:30:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11642151..11642904 2213..2966 3770 100 Plus
3L 28110227 3L 11634614..11635192 197..775 2880 99.8 Plus
3L 28110227 3L 11640651..11641195 899..1443 2725 100 Plus
3L 28110227 3L 11641261..11641773 1444..1956 2565 100 Plus
3L 28110227 3L 11641833..11642089 1957..2213 1285 100 Plus
3L 28110227 3L 11631395..11631590 1..196 980 100 Plus
3L 28110227 3L 11640068..11640197 775..904 650 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:35:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11635251..11636004 2213..2966 3770 100 Plus
3L 28103327 3L 11627714..11628292 197..775 2880 99.8 Plus
3L 28103327 3L 11633751..11634295 899..1443 2725 100 Plus
3L 28103327 3L 11634361..11634873 1444..1956 2565 100 Plus
3L 28103327 3L 11634933..11635189 1957..2213 1285 100 Plus
3L 28103327 3L 11624495..11624690 1..196 980 100 Plus
3L 28103327 3L 11633168..11633297 775..904 650 100 Plus
Blast to na_te.dros performed 2014-11-27 15:30:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 2194..2240 538..584 118 72.3 Plus

FI02074.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:31:13 Download gff for FI02074.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11633061..11633817 2214..2964 98   Plus
chr3L 11632748..11633004 1957..2213 98 -> Plus
chr3L 11632176..11632688 1444..1956 99 -> Plus
chr3L 11631572..11632110 905..1443 97 -> Plus
chr3L 11630981..11631110 775..904 100 -> Plus
chr3L 11625713..11626090 391..774 90 -> Plus
chr3L 11625510..11625575 197..262 100 == Plus
chr3L 11622311..11622506 1..196 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:38:01 Download gff for FI02074.complete
Subject Subject Range Query Range Percent Splice Strand
CG32091-RB 1..1872 684..2555 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:27:00 Download gff for FI02074.complete
Subject Subject Range Query Range Percent Splice Strand
CG32091-RB 1..1872 684..2555 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:02:24 Download gff for FI02074.complete
Subject Subject Range Query Range Percent Splice Strand
CG32091-RB 1..1872 684..2555 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:31:13 Download gff for FI02074.complete
Subject Subject Range Query Range Percent Splice Strand
CG32091-RB 1..1872 684..2555 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:38:01 Download gff for FI02074.complete
Subject Subject Range Query Range Percent Splice Strand
CG32091-RB 1..2964 1..2964 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:27:00 Download gff for FI02074.complete
Subject Subject Range Query Range Percent Splice Strand
CG32091-RB 1..2964 1..2964 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:02:24 Download gff for FI02074.complete
Subject Subject Range Query Range Percent Splice Strand
CG32091-RB 4..2967 1..2964 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:31:13 Download gff for FI02074.complete
Subject Subject Range Query Range Percent Splice Strand
CG32091-RB 4..2967 1..2964 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:31:13 Download gff for FI02074.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11642152..11642902 2214..2964 100   Plus
3L 11641833..11642089 1957..2213 100 -> Plus
3L 11641261..11641773 1444..1956 100 -> Plus
3L 11640657..11641195 905..1443 100 -> Plus
3L 11640068..11640197 775..904 100 -> Plus
3L 11634614..11635191 197..774 99 -> Plus
3L 11631395..11631590 1..196 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:02:24 Download gff for FI02074.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11635252..11636002 2214..2964 100   Plus
arm_3L 11634933..11635189 1957..2213 100 -> Plus
arm_3L 11634361..11634873 1444..1956 100 -> Plus
arm_3L 11633757..11634295 905..1443 100 -> Plus
arm_3L 11633168..11633297 775..904 100 -> Plus
arm_3L 11627714..11628291 197..774 99 -> Plus
arm_3L 11624495..11624690 1..196 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:59:32 Download gff for FI02074.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11635252..11636002 2214..2964 100   Plus
3L 11634933..11635189 1957..2213 100 -> Plus
3L 11634361..11634873 1444..1956 100 -> Plus
3L 11633757..11634295 905..1443 100 -> Plus
3L 11633168..11633297 775..904 100 -> Plus
3L 11627714..11628291 197..774 99 -> Plus
3L 11624495..11624690 1..196 100 -> Plus

FI02074.pep Sequence

Translation from 683 to 2554

> FI02074.pep
MEQSQNLLAKQSKNVEFQDVYYTVKERKNFWRVTGERRILNGVSGSFRNG
QLSAIMGPSGAGKSSLLNAISGFRRDGVTGNIKMKRDNACYITQDDHHQT
LLTVEELMNLACDLKLKNRHKKAEIMTDILENLHLNHRRNVTAEKLSGGE
RKRLSIALELVDNPNIFFLDEPTSGLDEVTAAQCIRLLQAMAYEGRTIVC
TIHQPSATIYNYFDSIYVLAKGQCVYQGSPRATIPFLRLAQLDCPRHYSP
SDYIIELVDAEDGHLVPALSDLTENGKLIYVVSQSEQLAPQQAVTTMFLE
QQKRPFLPAFFAGSAASTDGTLIGGTSALLEQVKAFSKRLHTDRRDVCGF
RQFIVLMRIMLLRITRARLALTIQLFHHLLCGLFFGLIFFQLGNQGARMF
DHLKFCIGAVLMIVYTQVMVPILSYPAEVKLVKKETFNRWYTLTPYYMAL
TVSRLPVQVLLNITFMAVTYWMSGLPQQFWRFCIFVAVGLMISLVAEGMG
LAIGATFSITNGSVVGPMLIAPLMGLAVYGFDFAPQVSGGMQLLMKFSYV
RVGVVSLVLAVFGFQREELDCDAIYCHFSDPRVLLKFLDVEKVSMLHQFG
LLAMLMLFFRVMMYISLRKRCYA*

FI02074.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25279-PA 627 GF25279-PA 1..627 1..623 3061 90 Plus
Dana\GF15046-PA 701 GF15046-PA 38..696 5..620 995 33.4 Plus
Dana\GF15689-PA 822 GF15689-PA 157..821 14..622 975 32.7 Plus
Dana\GF14147-PA 693 GF14147-PA 99..688 5..620 956 35 Plus
Dana\GF15020-PA 835 GF15020-PA 147..832 14..622 950 31.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15518-PA 623 GG15518-PA 1..623 1..623 3254 96.8 Plus
Dere\GG24682-PA 699 GG24682-PA 37..694 5..620 1025 34.3 Plus
Dere\GG24992-PA 831 GG24992-PA 144..828 14..622 944 31.8 Plus
Dere\GG23992-PA 691 GG23992-PA 97..686 5..620 938 35 Plus
Dere\GG24808-PA 763 GG24808-PA 105..759 14..620 932 33.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14862-PA 628 GH14862-PA 1..628 1..623 2820 82.6 Plus
Dgri\GH10667-PA 692 GH10667-PA 94..687 1..620 952 34.4 Plus
Dgri\GH11718-PA 676 GH11718-PA 53..648 14..620 931 33.8 Plus
Dgri\GH11164-PA 610 GH11164-PA 1..606 1..620 920 32 Plus
Dgri\GH11649-PA 845 GH11649-PA 178..844 14..622 918 33.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG32091-PB 623 CG32091-PB 1..623 1..623 3201 100 Plus
CG3164-PD 698 CG3164-PD 36..691 5..618 1022 34.9 Plus
CG3164-PB 698 CG3164-PB 36..691 5..618 1022 34.9 Plus
CG3164-PC 699 CG3164-PC 37..692 5..618 1022 34.9 Plus
CG3164-PA 699 CG3164-PA 37..692 5..618 1022 34.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13713-PA 624 GI13713-PA 1..624 1..623 2844 82.7 Plus
Dmoj\GI16213-PA 677 GI16213-PA 54..649 14..620 966 34.2 Plus
Dmoj\GI11007-PA 691 GI11007-PA 97..686 5..620 946 33.6 Plus
Dmoj\GI17876-PA 610 GI17876-PA 14..606 14..620 934 33 Plus
Dmoj\GI16191-PA 643 GI16191-PA 36..613 5..535 921 35.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16273-PA 301 GL16273-PA 1..301 323..623 1436 87.4 Plus
Dper\GL16274-PA 261 GL16274-PA 1..256 1..283 1197 80.9 Plus
Dper\GL16550-PA 699 GL16550-PA 37..694 5..620 1054 34.6 Plus
Dper\GL26409-PA 816 GL26409-PA 147..815 14..622 972 33 Plus
Dper\GL26576-PA 611 GL26576-PA 1..607 1..620 911 32.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16671-PA 627 GA16671-PA 1..627 1..623 2973 87.1 Plus
Dpse\GA16356-PA 699 GA16356-PA 37..694 5..620 1054 34.6 Plus
Dpse\GA28851-PA 816 GA28851-PA 147..815 14..622 971 33 Plus
Dpse\GA19180-PA 696 GA19180-PA 102..694 5..623 940 33.9 Plus
Dpse\GA16397-PA 611 GA16397-PA 1..607 1..620 910 32.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25287-PA 623 GM25287-PA 1..623 1..623 3300 98.2 Plus
Dsec\GM16700-PA 714 GM16700-PA 77..709 34..620 1030 35.3 Plus
Dsec\GM18155-PA 811 GM18155-PA 150..810 14..622 944 32.9 Plus
Dsec\GM18463-PA 834 GM18463-PA 146..831 14..622 937 31.8 Plus
Dsec\GM18358-PA 615 GM18358-PA 1..611 1..620 914 31.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22988-PA 698 GD22988-PA 36..693 5..620 1033 34.4 Plus
Dsim\GD22766-PA 811 GD22766-PA 150..810 14..622 935 32.6 Plus
Dsim\GD22321-PA 689 GD22321-PA 95..684 5..620 927 33.9 Plus
Dsim\GD23112-PA 758 GD23112-PA 105..754 14..620 905 33.1 Plus
Dsim\GD22989-PA 677 GD22989-PA 53..649 14..620 889 32.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14057-PA 628 GJ14057-PA 1..628 1..623 2788 82.5 Plus
Dvir\GJ16204-PA 703 GJ16204-PA 39..698 5..620 1046 34.5 Plus
Dvir\GJ16206-PA 677 GJ16206-PA 54..649 14..620 953 33.4 Plus
Dvir\GJ17376-PA 605 GJ17376-PA 1..601 1..620 941 33.2 Plus
Dvir\GJ22779-PA 760 GJ22779-PA 93..756 11..620 935 33.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12677-PA 643 GK12677-PA 12..643 4..623 2897 85.3 Plus
Dwil\GK24455-PA 699 GK24455-PA 34..694 5..620 1018 34 Plus
Dwil\GK14538-PA 698 GK14538-PA 104..693 5..620 934 34.2 Plus
Dwil\GK24575-PA 616 GK24575-PA 1..612 1..620 933 32.2 Plus
Dwil\GK18351-PA 740 GK18351-PA 101..733 11..617 889 32.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21833-PA 697 GE21833-PA 106..697 32..623 3099 97.3 Plus
Dyak\GE16449-PA 699 GE16449-PA 37..694 5..620 1044 34.7 Plus
Dyak\GE10137-PA 690 GE10137-PA 96..685 5..620 929 33.9 Plus
Dyak\GE14909-PA 810 GE14909-PA 149..809 14..622 924 32.4 Plus
Dyak\GE18174-PA 616 GE18174-PA 1..612 1..620 917 31.7 Plus

FI02074.hyp Sequence

Translation from 683 to 2554

> FI02074.hyp
MEQSQNLLAKQSKNVEFQDVYYTVKERKNFWRVTGERRILNGVSGSFRNG
QLSAIMGPSGAGKSSLLNAISGFRRDGVTGNIKMKRDNACYITQDDHHQT
LLTVEELMNLACDLKLKNRHKKAEIMTDILENLHLNHRRNVTAEKLSGGE
RKRLSIALELVDNPNIFFLDEPTSGLDEVTAAQCIRLLQAMAYEGRTIVC
TIHQPSATIYNYFDSIYVLAKGQCVYQGSPRATIPFLRLAQLDCPRHYSP
SDYIIELVDAEDGHLVPALSDLTENGKLIYVVSQSEQLAPQQAVTTMFLE
QQKRPFLPAFFAGSAASTDGTLIGGTSALLEQVKAFSKRLHTDRRDVCGF
RQFIVLMRIMLLRITRARLALTIQLFHHLLCGLFFGLIFFQLGNQGARMF
DHLKFCIGAVLMIVYTQVMVPILSYPAEVKLVKKETFNRWYTLTPYYMAL
TVSRLPVQVLLNITFMAVTYWMSGLPQQFWRFCIFVAVGLMISLVAEGMG
LAIGATFSITNGSVVGPMLIAPLMGLAVYGFDFAPQVSGGMQLLMKFSYV
RVGVVSLVLAVFGFQREELDCDAIYCHFSDPRVLLKFLDVEKVSMLHQFG
LLAMLMLFFRVMMYISLRKRCYA*

FI02074.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG32091-PB 623 CG32091-PB 1..623 1..623 3201 100 Plus
CG3164-PD 698 CG3164-PD 36..691 5..618 1022 34.9 Plus
CG3164-PB 698 CG3164-PB 36..691 5..618 1022 34.9 Plus
CG3164-PC 699 CG3164-PC 37..692 5..618 1022 34.9 Plus
CG3164-PA 699 CG3164-PA 37..692 5..618 1022 34.9 Plus