Clone FI02081 Report

Search the DGRC for FI02081

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:20
Well:81
Vector:pFlc-1
Associated Gene/TranscriptPyK-RA
Protein status:FI02081.pep: gold
Sequenced Size:2200

Clone Sequence Records

FI02081.complete Sequence

2200 bp assembled on 2009-04-17

GenBank Submission: BT082045.1

> FI02081.complete
GGTCGGGCTACCGACATTCTGAGCGCTTTTTCTGCGGCTAGGAAAATTTC
CGCTTGCCAAAAAATCTGTGTGGCAGTCGAACTTTTTGTCTCGTCCTCGC
CGCGTCCGATTTTCCATATATCCCGATTTTCGTCTCAAACTTGGAAGATA
TATTGCCAAAATATTGCATTCGGCTAGCCGCTGCGTTGTGTGTGTTGTTG
TGCGTGGAGTTGCGTGTGCAGTTGCAAGAAGATATAGTCGTCTATATCGT
CAGACCGATCTCGATCCCAAGTGCGATTCCCGTTGGTTACATACTACCCG
TTCGGTAGGCAACAAAATGGTGAACGTAACCATCTACGATGAGGCACCGC
AGCTGAAGCCCAACGAAGTACCCCAAAACATGGCCGCAGGAGCTGATACC
CAACTGGAGCACATGTGCCGTCTGCAGTTCGACTCGCCAGTGCCCCATGT
GCGTCTGTCCGGAATCGTGTGCACCATCGGACCTGCCTCCAGCAGCGTGG
AGATGCTGGAGAAGATGATGGCCACCGGCATGAACATCGCGCGCATGAAC
TTCTCTCACGGATCGCACGAGTACCATGCCGCCACCGTGGCCAATGTGCG
CCAGGCGGTGAAGAACTACTCGGCCAAGCTGGGCTACGAACACCCCGTGG
CCATTGCCCTGGACACCAAGGGGCCCGAGATCCGTACCGGTCTGATCGGA
GGCAGCGGCACCGCCGAGATTGAGCTGAAGAAGGGCGAGAAGATCAAGCT
GACCACCAACAAGGAATTCCTGGAGAAGGGCTCTCTGGAGATTGTGTACG
TGGACTACGAGAACATTGTCAATGTGGTGAAGCCCGGCAACCGGGTGTTC
GTCGATGACGGTCTGATCTCACTGATTGTCCGCGAGGTAGGCAAGGATTC
CCTCACCTGCGAGGTGGAGAACGGCGGCTCTCTGGGTTCCCGCAAGGGTG
TGAACCTGCCAGGCGTGCCCGTCGATCTGCCTGCCGTCTCCGAGAAGGAT
AAGAGCGATCTGCTGTTCGGTGTGGAGCAGGAAGTGGACATGATCTTTGC
TTCGTTCATCCGCAACGCCGCTGCTTTGACCGAGATCCGTAAGGTTCTTG
GCGAGAAGGGCAAGAACATCAAGATCATTTCCAAGATCGAGAACCAGCAG
GGCATGCACAACCTGGACGAGATCATCGAGGCCGGTGATGGCATTATGGT
GGCCCGTGGAGATCTGGGTATTGAGATTCCCGCCGAGAAGGTGTTCCTCG
CCCAGAAGGCCATGATTGCCCGCTGCAACAAGGCTGGCAAGCCTGTGATC
TGCGCCACTCAGATGTTGGAGTCAATGGTGAAGAAGCCACGTCCCACTCG
CGCTGAGATCTCTGATGTGGCCAACGCTGTGCTCGATGGTGCTGATTGCG
TCATGTTGTCTGGTGAGACCGCCAAGGGCGAGTACCCGCTGGAGTGCGTC
CTGACCATGGCCAAGACCTGCAAGGAGGCCGAGGCTGCCCTCTGGCACCA
GAACCTCTTTAACGACTTGGTTCGCGGCGCTGGTACCATCGATGCCTCTC
ACGCGGCTGCCATCGCTGCCGTTGAGGCTGCCACCAAGGCCAAGGCCTCC
GCCATCGTGGTGATCACCACCAGCGGCAAGTCGGCCTTCCAGGTGAGCAA
GTACCGCCCACGCTGCCCCATCATCGCGGTCACCCGTTTCGCGCAGACCG
CCCGACAGGCCCATCTCTACCGTGGACTGGTGCCACTCATCTACAAGGAG
CCCGGTCTTGGTGACTGGCTGAAGGACGTGGACGTGCGCGTGCAGTTCGG
TCTGCAGGTCGGAAAGAAGAACGGCTTCATCAAGACCGGCGATTCCGTCG
TGGTGGTTACCGGCTGGAAGCAGGGCTCCGGCTTCACCAACACCATCCGC
ATTGTCACCGTCGAATAAATTCTGCCGCTCAGGAAGTACCTGGATGCGTC
GCAGCTGCCGCGGGCGTCGCGTTGATTACTGTTAATAACCAAGTTAATTT
ATTAATTACACAATATTCGGAATATTGGAAACTGCAGGAGGCTGCTGGAA
CCGCTGTCAGAAGCGCCGAAGGCCGGCCCGGGCCTCAAACAGACACACAA
ATATACTATACCATTGTTGAATAATAGAGATTTCTTCGAAAATTATAATA
AAGTCATCACTGTATTTATGTACGTATGGAAAGCAAAAAAAAAAAAAAAA

FI02081.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
PyK-RA 2212 PyK-RA 2..2183 2..2183 10910 100 Plus
PyK.d 1968 PyK.d 141..1967 357..2183 9135 100 Plus
PyK-RB 2078 PyK-RB 223..2049 357..2183 9135 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18194323..18195714 357..1748 6960 100 Plus
chr3R 27901430 chr3R 18192756..18193112 2..358 1725 98.9 Plus
chr3R 27901430 chr3R 18196016..18196293 1906..2183 1390 100 Plus
chr3R 27901430 chr3R 18195772..18195929 1748..1905 790 100 Plus
chr3R 27901430 chr3R 18197169..18197727 912..1470 530 73 Plus
chr3R 27901430 chr3R 10578156..10578345 1463..1274 260 75.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
PyK-RA 1602 CG7070-PA 1..1602 317..1918 8010 100 Plus
PyK-RB 1539 CG7070-PB 1..1539 380..1918 7695 100 Plus
CG7069-RA 2235 CG7069-PA 386..944 912..1470 530 73 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:07:50 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
PyK-RA 2109 CG7070-RA 1..2109 75..2183 10545 100 Plus
PyK-RB 1958 CG7070-RB 132..1958 357..2183 9135 100 Plus
CG7069-RA 2693 CG7069-RA 736..1294 912..1470 530 73 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
PyK-PA 533 CG7070-PA 1..533 317..1915 2492 100 Plus
PyK-PB 512 CG7070-PB 1..512 380..1915 2381 100 Plus
CG2964-PA 554 CG2964-PA 14..513 398..1906 1150 47.8 Plus
CG7069-PA 744 CG7069-PA 1..461 530..1912 1136 56 Plus
CG7362-PB 793 CG7362-PB 109..413 950..1858 641 47.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22370776..22372167 357..1748 6960 100 Plus
3R 32079331 3R 22369209..22369565 2..358 1785 100 Plus
3R 32079331 3R 22372469..22372746 1906..2183 1390 100 Plus
3R 32079331 3R 22372225..22372382 1748..1905 790 100 Plus
3R 32079331 3R 22373622..22374180 912..1470 530 73 Plus
3R 32079331 3R 14753414..14753603 1463..1274 290 76.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22111607..22112998 357..1748 6960 100 Plus
3R 31820162 3R 22110040..22110396 2..358 1785 100 Plus
3R 31820162 3R 22113300..22113577 1906..2183 1390 100 Plus
3R 31820162 3R 22113056..22113213 1748..1905 790 100 Plus
3R 31820162 3R 22114815..22115011 1274..1470 400 80.2 Plus
3R 31820162 3R 14494245..14494434 1463..1274 290 76.8 Minus
3R 31820162 3R 22114728..22114798 1187..1257 145 80.2 Plus
Blast to na_te.dros performed on 2014-11-26 21:50:45 has no hits.

FI02081.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:41:45 Download gff for FI02081.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18196016..18196293 1906..2184 99   Plus
chr3R 18195773..18195929 1749..1905 100 -> Plus
chr3R 18194325..18195714 359..1748 100 -> Plus
chr3R 18192755..18193112 1..358 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:49:57 Download gff for FI02081.complete
Subject Subject Range Query Range Percent Splice Strand
PyK-RA 1..1602 317..1918 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:45:56 Download gff for FI02081.complete
Subject Subject Range Query Range Percent Splice Strand
PyK-RA 1..1602 317..1918 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:56:09 Download gff for FI02081.complete
Subject Subject Range Query Range Percent Splice Strand
PyK-RA 1..1602 317..1918 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:41:45 Download gff for FI02081.complete
Subject Subject Range Query Range Percent Splice Strand
PyK-RA 1..1602 317..1918 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-17 10:43:25 Download gff for FI02081.complete
Subject Subject Range Query Range Percent Splice Strand
PyK-RA 2..2172 2..2172 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:45:55 Download gff for FI02081.complete
Subject Subject Range Query Range Percent Splice Strand
PyK-RA 2..2172 2..2172 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:56:09 Download gff for FI02081.complete
Subject Subject Range Query Range Percent Splice Strand
PyK-RA 1..2109 75..2183 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:41:45 Download gff for FI02081.complete
Subject Subject Range Query Range Percent Splice Strand
PyK-RA 1..2109 75..2183 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:41:45 Download gff for FI02081.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22372469..22372746 1906..2184 99   Plus
3R 22372226..22372382 1749..1905 100 -> Plus
3R 22370778..22372167 359..1748 100 -> Plus
3R 22369208..22369565 1..358 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:56:09 Download gff for FI02081.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18198191..18198468 1906..2184 99   Plus
arm_3R 18197948..18198104 1749..1905 100 -> Plus
arm_3R 18196500..18197889 359..1748 100 -> Plus
arm_3R 18194930..18195287 1..358 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:21:16 Download gff for FI02081.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22113300..22113577 1906..2184 99   Plus
3R 22113057..22113213 1749..1905 100 -> Plus
3R 22111609..22112998 359..1748 100 -> Plus
3R 22110039..22110396 1..358 99 -> Plus

FI02081.pep Sequence

Translation from 316 to 1917

> FI02081.pep
MVNVTIYDEAPQLKPNEVPQNMAAGADTQLEHMCRLQFDSPVPHVRLSGI
VCTIGPASSSVEMLEKMMATGMNIARMNFSHGSHEYHAATVANVRQAVKN
YSAKLGYEHPVAIALDTKGPEIRTGLIGGSGTAEIELKKGEKIKLTTNKE
FLEKGSLEIVYVDYENIVNVVKPGNRVFVDDGLISLIVREVGKDSLTCEV
ENGGSLGSRKGVNLPGVPVDLPAVSEKDKSDLLFGVEQEVDMIFASFIRN
AAALTEIRKVLGEKGKNIKIISKIENQQGMHNLDEIIEAGDGIMVARGDL
GIEIPAEKVFLAQKAMIARCNKAGKPVICATQMLESMVKKPRPTRAEISD
VANAVLDGADCVMLSGETAKGEYPLECVLTMAKTCKEAEAALWHQNLFND
LVRGAGTIDASHAAAIAAVEAATKAKASAIVVITTSGKSAFQVSKYRPRC
PIIAVTRFAQTARQAHLYRGLVPLIYKEPGLGDWLKDVDVRVQFGLQVGK
KNGFIKTGDSVVVVTGWKQGSGFTNTIRIVTVE*

FI02081.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18439-PA 530 GF18439-PA 1..530 1..530 2627 95.8 Plus
Dana\GF14982-PA 555 GF14982-PA 14..513 28..530 1335 48.4 Plus
Dana\GF19944-PA 699 GF19944-PA 1..444 72..514 1141 52.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:14:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11123-PA 533 GG11123-PA 1..533 1..533 2793 98.5 Plus
Dere\GG24888-PA 554 GG24888-PA 14..513 28..530 1324 48.2 Plus
Dere\GG11124-PA 727 GG11124-PA 1..461 72..532 1297 55.6 Plus
Dere\GG21066-PA 891 GG21066-PA 238..539 210..514 728 50.2 Plus
Dere\GG21066-PA 891 GG21066-PA 148..260 28..140 216 35.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13278-PA 535 GH13278-PA 1..535 1..533 2539 92 Plus
Dgri\GH20329-PA 535 GH20329-PA 1..535 1..533 2533 91.8 Plus
Dgri\GH20341-PA 550 GH20341-PA 17..466 28..475 1392 57.3 Plus
Dgri\GH13289-PA 550 GH13289-PA 17..466 28..475 1390 57.3 Plus
Dgri\GH19261-PA 539 GH19261-PA 1..508 22..530 1311 49 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:14:09
Subject Length Description Subject Range Query Range Score Percent Strand
PyK-PA 533 CG7070-PA 1..533 1..533 2706 100 Plus
PyK-PB 512 CG7070-PB 1..512 22..533 2595 100 Plus
CG2964-PA 554 CG2964-PA 14..513 28..530 1268 47.8 Plus
CG7069-PA 744 CG7069-PA 1..461 72..532 1257 56.4 Plus
CG7362-PB 793 CG7362-PB 109..413 212..514 704 49.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22374-PA 535 GI22374-PA 1..535 1..533 2584 93.8 Plus
Dmoj\GI22375-PA 541 GI22375-PA 1..426 72..497 1307 57.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:14:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24201-PA 530 GL24201-PA 1..530 1..530 2582 91.9 Plus
Dper\GL24202-PA 502 GL24202-PA 1..443 72..514 1328 58.5 Plus
Dper\GL15445-PA 555 GL15445-PA 14..515 28..530 1314 47.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26534-PA 530 GA26534-PA 1..530 1..530 2596 92.1 Plus
Dpse\GA26534-PB 509 GA26534-PB 1..509 22..530 2480 91.9 Plus
Dpse\GA20296-PA 502 GA20296-PA 1..443 72..514 1326 58.5 Plus
Dpse\GA15544-PA 555 GA15544-PA 14..515 28..530 1315 47.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26420-PA 533 GM26420-PA 1..533 1..533 2826 99.6 Plus
Dsec\GM26421-PA 849 GM26421-PA 67..571 28..532 1404 54.9 Plus
Dsec\GM18368-PA 554 GM18368-PA 14..513 28..530 1323 48 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23184-PA 554 GD23184-PA 14..513 28..530 1323 48 Plus
Dsim\GD20940-PA 754 GD20940-PA 67..441 28..401 1275 62.7 Plus
Dsim\GD20939-PA 239 GD20939-PA 9..239 303..533 1087 97.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:14:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24408-PA 946 GJ24408-PA 1..534 1..532 2589 94.2 Plus
Dvir\GJ24408-PA 946 GJ24408-PA 533..802 211..478 877 62.3 Plus
Dvir\GJ11126-PA 339 GJ11126-PA 1..300 232..530 785 48.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:14:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14262-PA 533 GK14262-PA 1..533 1..533 2629 95.1 Plus
Dwil\GK21752-PA 534 GK21752-PA 7..515 20..530 1345 47.9 Plus
Dwil\GK18960-PA 593 GK18960-PA 1..490 30..518 1333 53.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\PyK-PA 533 GE10289-PA 1..533 1..533 2824 99.4 Plus
Dyak\GE10290-PA 824 GE10290-PA 53..557 28..532 1421 55.3 Plus
Dyak\GE18182-PA 556 GE18182-PA 14..513 28..530 1319 48 Plus
Dyak\smp-30-PA 757 GE26429-PA 85..377 184..478 731 50.7 Plus
Dyak\smp-30-PA 757 GE26429-PA 15..109 28..122 222 42.1 Plus

FI02081.hyp Sequence

Translation from 316 to 1917

> FI02081.hyp
MVNVTIYDEAPQLKPNEVPQNMAAGADTQLEHMCRLQFDSPVPHVRLSGI
VCTIGPASSSVEMLEKMMATGMNIARMNFSHGSHEYHAATVANVRQAVKN
YSAKLGYEHPVAIALDTKGPEIRTGLIGGSGTAEIELKKGEKIKLTTNKE
FLEKGSLEIVYVDYENIVNVVKPGNRVFVDDGLISLIVREVGKDSLTCEV
ENGGSLGSRKGVNLPGVPVDLPAVSEKDKSDLLFGVEQEVDMIFASFIRN
AAALTEIRKVLGEKGKNIKIISKIENQQGMHNLDEIIEAGDGIMVARGDL
GIEIPAEKVFLAQKAMIARCNKAGKPVICATQMLESMVKKPRPTRAEISD
VANAVLDGADCVMLSGETAKGEYPLECVLTMAKTCKEAEAALWHQNLFND
LVRGAGTIDASHAAAIAAVEAATKAKASAIVVITTSGKSAFQVSKYRPRC
PIIAVTRFAQTARQAHLYRGLVPLIYKEPGLGDWLKDVDVRVQFGLQVGK
KNGFIKTGDSVVVVTGWKQGSGFTNTIRIVTVE*

FI02081.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
PyK-PA 533 CG7070-PA 1..533 1..533 2706 100 Plus
PyK-PB 512 CG7070-PB 1..512 22..533 2595 100 Plus
CG2964-PA 554 CG2964-PA 14..513 28..530 1268 47.8 Plus
CG7069-PA 744 CG7069-PA 1..461 72..532 1257 56.4 Plus
CG7362-PB 793 CG7362-PB 109..413 212..514 704 49.8 Plus