Clone FI02090 Report

Search the DGRC for FI02090

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:20
Well:90
Vector:pFlc-1
Associated Gene/TranscriptCG5001-RA
Protein status:FI02090.pep: gold
Sequenced Size:1849

Clone Sequence Records

FI02090.complete Sequence

1849 bp assembled on 2009-01-06

GenBank Submission: BT056237.1

> FI02090.complete
GAGTGAGTCCCCAAGCGTTGTCGCGTCCACTTTATCGCTGTTTCTGTCGC
GGATTCGAACCACTGACTAACGGTAGTGCTGCACGCATCTGGCGGTAAAT
TGGCAGCGAGAAGCCCGCGCTAATAATACATTCTGAAAGCCGTCGAAAGG
ATTGCGAGTCCATATCAAGCATACGCCCGATCAGCCGCCAATCGATTATC
TTTTGCGATAGTAGAGCAGTGAAACAGCCAGAGAGAACGACAAGATGCAT
GTGCCATTATAAGGATAAAGGGAAGGATAGCAACTAAGCAGGTCCTCGTT
ATATATGGAAACCCAAAACTGATATTATTATACTAGACTACAGTGAACTT
GAGAGTCAACTCTTTACCCACATACTTAGAACCCACTCGCCCCCGCCCCC
AGAAGTAACCTGCAATGGGTAAGGACTACTACAAAATCCTGGGTCTGCCC
AAAACTGCCACCGACGATGAGATCAAAAAGGCCTACAGGAAACTGGCCCT
GCGTTATCATCCGGACAAAAACAAAGCCGCCAACGCCGAGGACAAGTTCA
AGGAGGTCGCCGAGGCGTACGAGGTTCTTTCGGACAAGAGCAAGCGGGAG
GTGTACGACAAATACGGCGAGGATGGTCTCAAGAGCGGAGGCACACGAAA
CGGCGGTCCGTCGAGCAACTCGTTTACATATCAGTTCCACGGCGATCCGC
GGGCCACCTTCGCCCAGTTCTTTGGCAACAGCAATCCGTTCGCCTCGTTC
TTCGACATGGGCGACAACCTGTTCGACAAGAAGGTCTTCGATCTGGACAC
GGAACCCGATTTCTTCTCCTCGCCCTTTGGCGGCATTGGGTCGCGACATG
GTCTGGGAAGTGGCTTCAGGCCCTCTTTCAGATCACACTCCTTCAATGTG
CACACGCCGTTCAAGAAGGAGCAGAAGCAGGATCCGCCCGTCGAACACGA
TCTCTATGTGACGCTGGAGGAGATCTACCACGGCTGTGTTAAGAAAATGA
AAATCTCCCGGCGCATCGTTCAGGCGGACGGCAGTTCCCGCAAGGAGGAG
AAGTTCCTGGCGATATCCATCAAGCCCGGCTGGAAGTCCGGCACCAAGGT
CACCTTCCAGAAGGAGGGCGACCAGGCGCCCGGAAAAATTCCCGCCGACA
TTGTGTTCATCATCCGGGACAAGCCGCACGCCATGTTCAAGCGCGAGGGC
AGCGATCTGCGCTACACGGCGAGACTGACGCTCAAGCAGGCTTTGTGCGG
CGTTGTCTTCCAAGTTCCTACCATGTCCGGCGACAAGTTGCGCATCAGCA
CCATGCAGGAGATCATCAAGCCGAACACGGTGAAGCGCATCCAGGGATAC
GGGCTGCCATTCCCCAAGGATACGACGCGCAAGGGCGACCTCCTGGTGGC
CTTCGACATTCAGTTCCCGGAGAAGCTGACCGCCGCCCAGAAGGAGGTGC
TCAAGGACATGTTATGAGGAGGGATCACTGGCCTGATCACTGACCGACGA
CTCCGATGCACCCGCAGTCCTTCGGTGAATCCAGGGACTTAGTCATCCAT
TCAAACGCACTAAAACCAAACCGATCCCATTCATTTTGTAACAACCCATC
GAGATCTTGCTCCCATTTTGCTTGTTTTTGTGTTCAGTGAAACATTTGCG
CATTTTTTACAGGAACTCCCTCTTAACAATCGGTTGTGCTCATCTGCGCC
GCGAACATGTTGCATAATATGTATGTTGACCATAGTTATTATATCATTAA
ATCTTAATTTATTTGTCTAAATTAAAGCTAAATTTAATAAAATGACACAC
ACACGCGTACACGTGAAAGAAAAAACAAGCTAAAAAAAAAAAAAAAAAA

FI02090.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:44:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG5001-RA 2001 CG5001-RA 65..1897 2..1834 9150 99.9 Plus
CG5001.c 2366 CG5001.c 535..2363 2..1830 9145 100 Plus
CG5001.b 1958 CG5001.b 125..1957 2..1830 9080 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1196165..1196758 1237..1830 2955 99.8 Plus
chr2L 23010047 chr2L 1192200..1192573 867..1240 1855 99.7 Plus
chr2L 23010047 chr2L 1191546..1191857 330..641 1530 99.4 Plus
chr2L 23010047 chr2L 1191915..1192146 639..870 1130 99.1 Plus
chr2L 23010047 chr2L 1186207..1186402 2..197 980 100 Plus
chr2L 23010047 chr2L 1191350..1191481 198..329 660 100 Plus
chr3L 24539361 chr3L 5743908..5744090 639..457 300 77.6 Minus
chr3L 24539361 chr3L 5743393..5743560 1208..1041 225 75.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG5001-RD 1053 CG5001-PD 1..1053 415..1467 5265 100 Plus
CG5001-RA 1053 CG5001-PA 1..1053 415..1467 5265 100 Plus
CG5001-RB 1053 CG5001-PB 1..1053 415..1467 5265 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:07:55 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG5001-RA 1833 CG5001-RA 4..1832 2..1830 9145 100 Plus
CG5001-RC 1825 CG5001-RC 4..1824 2..1830 8855 99.1 Plus
CG5001-RD 1755 CG5001-RD 122..1754 198..1830 8165 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG5001-PD 350 CG5001-PD 1..350 415..1464 1765 100 Plus
CG5001-PA 350 CG5001-PA 1..350 415..1464 1765 100 Plus
CG5001-PB 350 CG5001-PB 1..350 415..1464 1765 100 Plus
CG5001-PC 346 CG5001-PC 1..346 415..1464 1729 98.6 Plus
DnaJ-1-PA 334 CG10578-PA 1..332 415..1464 1025 55.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1196213..1196810 1237..1834 2975 99.8 Plus
2L 23513712 2L 1192253..1192626 867..1240 1870 100 Plus
2L 23513712 2L 1191599..1191910 330..641 1560 100 Plus
2L 23513712 2L 1191968..1192199 639..870 1160 100 Plus
2L 23513712 2L 1186257..1186452 2..197 980 100 Plus
2L 23513712 2L 1191403..1191534 198..329 660 100 Plus
3L 28110227 3L 5751369..5751551 639..457 300 77.6 Minus
3L 28110227 3L 5750854..5751021 1208..1041 195 74.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1196213..1196810 1237..1834 2975 99.8 Plus
2L 23513712 2L 1192253..1192626 867..1240 1870 100 Plus
2L 23513712 2L 1191599..1191910 330..641 1560 100 Plus
2L 23513712 2L 1191968..1192199 639..870 1160 100 Plus
2L 23513712 2L 1186257..1186452 2..197 980 100 Plus
2L 23513712 2L 1191403..1191534 198..329 660 100 Plus
3L 28103327 3L 5744469..5744561 639..547 210 81.7 Minus
3L 28103327 3L 5744380..5744423 725..682 175 93.1 Minus
3L 28103327 3L 5744584..5744651 524..457 160 82.3 Minus
Blast to na_te.dros performed 2014-11-26 21:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1036..1100 1726..1792 114 65.7 Plus

FI02090.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:42:07 Download gff for FI02090.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1196168..1196758 1240..1831 99   Plus
chr2L 1192203..1192572 870..1239 99 -> Plus
chr2L 1191917..1192145 641..869 99 -> Plus
chr2L 1191546..1191856 330..640 99 -> Plus
chr2L 1191350..1191481 198..329 100 -> Plus
chr2L 1186206..1186402 1..197 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:37:27 Download gff for FI02090.complete
Subject Subject Range Query Range Percent Splice Strand
CG5001-RA 1..1053 415..1467 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:22:46 Download gff for FI02090.complete
Subject Subject Range Query Range Percent Splice Strand
CG5001-RA 1..1053 415..1467 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:56:24 Download gff for FI02090.complete
Subject Subject Range Query Range Percent Splice Strand
CG5001-RB 1..1053 415..1467 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:42:07 Download gff for FI02090.complete
Subject Subject Range Query Range Percent Splice Strand
CG5001-RB 1..1053 415..1467 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:37:26 Download gff for FI02090.complete
Subject Subject Range Query Range Percent Splice Strand
CG5001-RA 2..1830 2..1830 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:22:46 Download gff for FI02090.complete
Subject Subject Range Query Range Percent Splice Strand
CG5001-RA 2..1830 2..1830 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:56:24 Download gff for FI02090.complete
Subject Subject Range Query Range Percent Splice Strand
CG5001-RA 3..1832 1..1831 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:42:07 Download gff for FI02090.complete
Subject Subject Range Query Range Percent Splice Strand
CG5001-RA 3..1832 1..1831 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:42:07 Download gff for FI02090.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1196216..1196806 1240..1831 99   Plus
2L 1192256..1192625 870..1239 100 -> Plus
2L 1191970..1192198 641..869 100 -> Plus
2L 1191599..1191909 330..640 100 -> Plus
2L 1191403..1191534 198..329 100 -> Plus
2L 1186256..1186452 1..197 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:56:24 Download gff for FI02090.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1196216..1196806 1240..1831 99   Plus
arm_2L 1192256..1192625 870..1239 100 -> Plus
arm_2L 1191970..1192198 641..869 100 -> Plus
arm_2L 1191599..1191909 330..640 100 -> Plus
arm_2L 1191403..1191534 198..329 100 -> Plus
arm_2L 1186256..1186452 1..197 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:10:30 Download gff for FI02090.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1196216..1196806 1240..1831 99   Plus
2L 1192256..1192625 870..1239 100 -> Plus
2L 1191970..1192198 641..869 100 -> Plus
2L 1191599..1191909 330..640 100 -> Plus
2L 1191403..1191534 198..329 100 -> Plus
2L 1186256..1186452 1..197 99 -> Plus

FI02090.pep Sequence

Translation from 414 to 1466

> FI02090.pep
MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAE
AYEVLSDKSKREVYDKYGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFA
QFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSG
FRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRR
IVQADGSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFII
RDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEI
IKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML
*

FI02090.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 00:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15175-PA 346 GF15175-PA 1..346 1..350 1757 94.6 Plus
Dana\GF10450-PA 354 GF10450-PA 1..352 1..350 1084 58.6 Plus
Dana\GF19555-PA 334 GF19555-PA 1..332 1..350 952 52.5 Plus
Dana\GF17599-PA 403 GF17599-PA 7..350 5..350 381 30.1 Plus
Dana\GF24837-PA 366 GF24837-PA 7..345 4..348 377 28.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 00:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24779-PA 350 GG24779-PA 1..350 1..350 1845 99.1 Plus
Dere\DnaJ-1-PA 351 GG14117-PA 1..349 1..350 1040 57.5 Plus
Dere\GG18918-PA 332 GG18918-PA 1..319 1..339 848 48.7 Plus
Dere\GG19654-PA 403 GG19654-PA 7..350 5..350 390 31.7 Plus
Dere\GG14825-PA 366 GG14825-PA 7..344 4..347 364 28.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 00:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11404-PA 346 GH11404-PA 1..346 1..350 1729 92.6 Plus
Dgri\GH15011-PA 353 GH15011-PA 1..351 1..350 1032 58.8 Plus
Dgri\GH16434-PA 366 GH16434-PA 7..345 4..348 413 29.1 Plus
Dgri\GH19043-PA 405 GH19043-PA 7..352 5..350 370 30.4 Plus
Dgri\GH16902-PA 127 GH16902-PA 1..87 1..85 273 60.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG5001-PD 350 CG5001-PD 1..350 1..350 1842 100 Plus
CG5001-PA 350 CG5001-PA 1..350 1..350 1842 100 Plus
CG5001-PB 350 CG5001-PB 1..350 1..350 1842 100 Plus
CG5001-PC 346 CG5001-PC 1..346 1..350 1805 98.9 Plus
DnaJ-1-PA 334 CG10578-PA 1..332 1..350 1034 57 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 00:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14539-PA 347 GI14539-PA 1..347 1..350 1619 89.7 Plus
Dmoj\GI13174-PA 352 GI13174-PA 1..350 1..350 1052 59.2 Plus
Dmoj\GI15199-PA 325 GI15199-PA 1..322 1..350 969 56.4 Plus
Dmoj\GI12518-PA 368 GI12518-PA 7..345 4..348 394 28.4 Plus
Dmoj\GI24337-PA 404 GI24337-PA 7..351 5..350 374 30.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 00:03:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15626-PA 318 GL15626-PA 1..312 1..318 1535 91.8 Plus
Dper\GL16659-PA 158 GL16659-PA 1..156 195..350 559 63.5 Plus
Dper\GL20776-PA 230 GL20776-PA 1..166 1..165 427 56.1 Plus
Dper\GL24472-PA 404 GL24472-PA 7..351 5..350 384 30.5 Plus
Dper\GL25304-PA 366 GL25304-PA 7..345 4..348 379 28.6 Plus
Dper\GL20776-PA 230 GL20776-PA 164..228 283..350 183 48.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 00:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18584-PA 346 GA18584-PA 1..346 1..350 1752 94.6 Plus
Dpse\GA10408-PA 353 GA10408-PA 1..351 1..350 1074 59.8 Plus
Dpse\GA21376-PA 404 GA21376-PA 7..351 5..350 390 31.1 Plus
Dpse\GA11343-PA 366 GA11343-PA 7..345 4..348 378 28.6 Plus
Dpse\GA19562-PA 250 GA19562-PA 15..86 2..72 235 63.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 00:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16806-PA 350 GM16806-PA 1..350 1..350 1851 99.4 Plus
Dsec\DnaJ-1-PA 337 GM13903-PA 1..335 1..350 1051 57.4 Plus
Dsec\GM11309-PA 344 GM11309-PA 1..342 1..350 618 38.8 Plus
Dsec\GM14447-PA 366 GM14447-PA 7..345 4..348 379 28.7 Plus
Dsec\GM22099-PA 128 GM22099-PA 1..92 1..109 267 49.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 00:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23083-PA 346 GD23083-PA 1..346 1..350 1815 98.3 Plus
Dsim\DnaJ-1-PA 352 GD13179-PA 1..350 1..350 1053 58.1 Plus
Dsim\GD16032-PA 300 GD16032-PA 123..298 176..350 437 46 Plus
Dsim\GD18906-PA 403 GD18906-PA 7..350 5..350 382 30.3 Plus
Dsim\GD13648-PA 366 GD13648-PA 7..345 4..348 376 28.4 Plus
Dsim\GD16032-PA 300 GD16032-PA 1..80 1..80 227 55 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 00:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16971-PA 347 GJ16971-PA 1..347 1..350 1675 92.9 Plus
Dvir\GJ11949-PA 351 GJ11949-PA 1..349 1..350 1035 58.4 Plus
Dvir\GJ14805-PA 325 GJ14805-PA 1..322 1..350 968 57.1 Plus
Dvir\GJ10422-PA 403 GJ10422-PA 7..350 5..350 378 30.6 Plus
Dvir\GJ12422-PA 358 GJ12422-PA 7..299 4..315 375 29.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 00:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15183-PA 346 GK15183-PA 1..346 1..350 1752 94.3 Plus
Dwil\GK16875-PA 356 GK16875-PA 1..354 1..350 1092 58.3 Plus
Dwil\GK19767-PA 330 GK19767-PA 1..328 1..350 953 55.9 Plus
Dwil\GK10421-PA 316 GK10421-PA 1..314 1..350 896 52.7 Plus
Dwil\GK20532-PA 366 GK20532-PA 7..345 4..348 415 31.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 00:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17451-PA 350 GE17451-PA 1..350 1..350 1845 99.1 Plus
Dyak\DnaJ-1-PA 351 GE20542-PA 1..349 1..350 1048 57.2 Plus
Dyak\GE26270-PA 403 GE26270-PA 7..350 5..350 375 30.1 Plus
Dyak\GE21189-PA 366 GE21189-PA 7..344 4..347 372 28.6 Plus
Dyak\GE22992-PA 127 GE22992-PA 1..74 1..74 272 64.9 Plus

FI02090.hyp Sequence

Translation from 414 to 1466

> FI02090.hyp
MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAE
AYEVLSDKSKREVYDKYGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFA
QFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSG
FRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRR
IVQADGSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFII
RDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEI
IKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML
*

FI02090.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG5001-PD 350 CG5001-PD 1..350 1..350 1842 100 Plus
CG5001-PA 350 CG5001-PA 1..350 1..350 1842 100 Plus
CG5001-PB 350 CG5001-PB 1..350 1..350 1842 100 Plus
CG5001-PC 346 CG5001-PC 1..346 1..350 1805 98.9 Plus
DnaJ-1-PA 334 CG10578-PA 1..332 1..350 1034 57 Plus