Clone FI02157 Report

Search the DGRC for FI02157

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:21
Well:57
Vector:pFlc-1
Associated Gene/Transcriptbeat-Ib-RA
Protein status:FI02157.pep: gold
Sequenced Size:2624

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
beat-Ib 2008-12-18 5.12 accounting

Clone Sequence Records

FI02157.complete Sequence

2624 bp assembled on 2008-10-24

GenBank Submission: BT050436.1

> FI02157.complete
GGTTTCATTGATAACGCGCAACGAATTGGATCTCAGTCAAACGCCGGCCA
GCTGCACTGTCACAAAATTCGTTTTCGTGGCTGCAAATTCACAAAGAAAA
CAGATTAAAAACGACATCTGTAATGTAACTATATCGTGTTTTGCTCAGAA
GTAATGCTGATGACTCACTAGCTTCATAGTTTCTCGAACCAATACTCGGC
TCATTGATTCTTCGCTTGTTTTTTCGCAGCGCGTGTGTTTAATTATATAG
ACCATGTGGATTACTGTGCCACTGGCAAAAACAACAACGAAACCAGCAAA
TTAATTCAATCGTGTGCAATCTGCTTGTGGGTGCCAATTTGGGTTTCCTT
TCAAATTAGTGCGATAATGATATAGACTGAACTGAAATCAAAAATAAAAT
TACAATATGCCGGCAATTCAAAATGGTAAATAAGTTAATTCGGAAGCCGA
ATCCAGTTCAATCATCATCCAGCAACATTGTGGAATTCCCAAGCAGGAAA
AGGAAAAGCTGGGAGTGAGCCGAAGTCATATAAAATACATAGCAGCAAAG
TGGAAAAATTGTGGAAAGCAGGAAATGAATATGCAAAAAAGGGCAGAAGG
GATATGAAAAATGCAAATAGCCAAATCGAGTTCAATGAGAAATGCAGCTA
ACCCTAAGCCGAGCGTATTTACACAATTTCACATGCAAGGCAACAGCAGT
GGCATTCAGGTAGTTCGGGGCACACAGGACCAGGTCACAGTCCGAATACA
AATGCGACTCACTGTGCTGATTGCTAATTGTGGCTGACTGGTAAACCGAA
GAAAGCAAGAGCGCCGAATGAAAAATGCATTAAATGCAACCACAAAATAG
AGCAAAAAGTAAAACCAATCAAACGACAAAAAAGGGGAAATTGCACATAC
TGAGCGCAGAGCAAAACAAAAGGATGACAAAACCAGTTAGCGAATATTAA
AATTGATTTCTGCGGTCTGGATAGCGGATATTGCTCATATATGTACGTCA
ATCGGTTGCAAAGGGCAGCGTGATATAAAAAATTAGCTGATTTATAAATA
AACAATCATATTTGTGGGCAAAAGGACATAAAATGCAAAAGCCAGCGCTT
AAACTGCGTCGACTCTTCATCATTACCGCAATTTATATAGCCAGTTTGCC
AGGTCTCACTGTTGGGCTGCGGAACGTCAACGTTCGCATACCGTCCGCCG
TTAAGCGTGGCGATAATGCGCTCTTAATCTGCAATTATGACATCGAGAAC
GACACGCTCTACACGGTGAAATGGTATCGTGGCAGACGGGAGTTCTACCG
CTATACGCCCAAGGAAAATCCGGCCTGGAAGATATTCACCAAAACGAACG
AAATCGATGTCGAGACTGCCCAATCGAATGCCAGCCACGTTCTTTTGCGA
AATGTTCCCACCTCAATATCGGGCAAATTTGCCTGCGAAGTGTCCGCAGA
TGCACCCACCTTCGATACTTCCATCGTGGCCGCCGACATGGAGGTGGTTG
AATTGCCCACCCAACGACCCATAATTACTGGCATCCATTCAAGATACCGT
CTGGGGGACGTTATAAATGGGAACTGCTCATCGGATTACTCCAAGCCGGC
TGCGAATCTCACCTGGTGGATCAATGACATACAGGTGCCACCCAATTATC
TCCGCATCTACGACATTCAGCGGCACGTGGCCGAGCATCTGGAGTCGGCG
GTTTTGGAGATCAAATTCGTGGTGACGGTACATCACTTCATCAAGAGTCG
CTTAAAGTTGAAATGTTCGGCAAGGATACACGAAATTTACGCACAGGAGA
GCGAAAAATTAATCGAGGAAGATCGTCCCAGGATTCTGGCCTCTGGCAGA
TCACCTGATATGAATATGTATCCATTTGATCAGCCAGGGGATGCAGATGA
GCATAACGAACTATTTTTGATCCATTCAAATGCGGCTTGCGGACCATTTG
CCTGGCATCCGATTTTGTTTTTGCTGTTGTGGCCAAGTTTCTGGGTTTTC
GCCGCCTGGGAGAACTGGCTGTGGAACCTGTTGGAGGCTCGACTTTTTGG
CAGGGCGGTGCGGTGATAGGATGGCCAATGGCAGGAGAGATGGACTTTAG
GCGGGACTTGAGACGGATGAGAAACCGTGCTCAGGCTCGGCAATAACGGT
ACCCACATTTAGCGAATCGATTAGCAAATCAAGAGTGAAGGGTCCTCAGC
ATACCGAATATACCTACTCACATACACCTACATCTATGTTAAGTACGTAA
CTGTAAAGACAAATGCATTTCCAAAGACCCGTACTCCTCTATTCCTAAGT
AAAGTGTAAATAGGCATCGAGCACTTCCTCGCATACTCAACAGGAATATA
TATATATACTACATACATATATATGTATATGTATATATACATAAAAATAT
ATCTACTCTCTAAGCAGGATTCTAAATGTTTGCTTTCGTTGGGTTTTCGA
CGATTCATTGTTAAGATTGTGGTTTCTAGGCAGATTCATTGTTCTGTTCG
TCTGTGTCTGTACAACTAAAATGATTAGCCGTAGCTTTAACATTAGTGTG
ATCTTAAGTTGAAAGTGTGTTCTATTGATGGAAGCCAAATAAAGATGGTT
TTATTTGATCAAAAAAAAAAAAAA

FI02157.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
beat-Ib-RB 2608 beat-Ib-RB 1..2608 2..2610 12975 99.8 Plus
beat-Ib-RA 2604 beat-Ib-RA 5..2604 2..2610 12830 99.5 Plus
beat-Ic-RA 4113 beat-Ic-RA 1155..1264 1215..1324 190 78.1 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15938161..15938881 1154..434 3605 100 Minus
chr2L 23010047 chr2L 15903924..15904600 2610..1925 3105 97.5 Minus
chr2L 23010047 chr2L 15960790..15961223 435..2 2155 99.8 Minus
chr2L 23010047 chr2L 15905328..15905585 1757..1500 1290 100 Minus
chr2L 23010047 chr2L 15906846..15907065 1364..1145 1085 99.5 Minus
chr2L 23010047 chr2L 15905094..15905267 1929..1756 870 100 Minus
chr2L 23010047 chr2L 15905643..15905780 1500..1363 690 100 Minus
chr2L 23010047 chr2L 16031219..16031328 1215..1324 190 78.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
beat-Ib-RB 984 CG7644-PB 1..984 1083..2066 4920 100 Plus
beat-Ib-RA 984 CG7644-PA 1..984 1083..2066 4920 100 Plus
beat-Ic-RC 1605 CG4838-PC 217..326 1215..1324 190 78.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:05 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
beat-Ib-RB 2611 CG7644-RB 4..2611 2..2610 12965 99.9 Plus
beat-Ib-RA 2603 CG7644-RA 4..2603 2..2610 12810 99.6 Plus
beat-Ic-RC 4695 CG4838-RC 1134..1243 1215..1324 190 78.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
beat-Ib-PB 327 CG7644-PB 1..327 1083..2063 1741 100 Plus
beat-Ib-PA 327 CG7644-PA 1..327 1083..2063 1741 100 Plus
beat-Ic-PC 534 CG4838-PC 40..338 1116..1988 820 51.2 Plus
beat-Ic-PB 534 CG4838-PB 40..338 1116..1988 820 51.2 Plus
beat-Ic-PA 534 CG4838-PA 40..338 1116..1988 820 51.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15939362..15940082 1154..434 3605 100 Minus
2L 23513712 2L 15905133..15905818 2611..1925 3340 99.4 Minus
2L 23513712 2L 15961999..15962432 435..2 2170 100 Minus
2L 23513712 2L 15906549..15906806 1757..1500 1290 100 Minus
2L 23513712 2L 15908067..15908286 1364..1145 1085 99.5 Minus
2L 23513712 2L 15906318..15906491 1929..1756 870 100 Minus
2L 23513712 2L 15906864..15907001 1500..1363 690 100 Minus
2L 23513712 2L 16032442..16032551 1215..1324 190 78.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15939362..15940082 1154..434 3605 100 Minus
2L 23513712 2L 15905133..15905818 2611..1925 3350 99.4 Minus
2L 23513712 2L 15961999..15962432 435..2 2170 100 Minus
2L 23513712 2L 15906549..15906806 1757..1500 1290 100 Minus
2L 23513712 2L 15908067..15908286 1364..1145 1085 99.5 Minus
2L 23513712 2L 15906318..15906491 1929..1756 870 100 Minus
2L 23513712 2L 15906864..15907001 1500..1363 690 100 Minus
2L 23513712 2L 16032442..16032551 1215..1324 190 78.1 Plus
Blast to na_te.dros performed 2014-11-27 09:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
invader2 5124 invader2 INVADER2 5124bp 708..743 82..47 117 80.6 Minus

FI02157.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:14:43 Download gff for FI02157.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15960792..15961223 1..433 99   Minus
chr2L 15938163..15938881 434..1152 100 <- Minus
chr2L 15906846..15907057 1153..1364 100 <- Minus
chr2L 15905643..15905778 1365..1500 100 <- Minus
chr2L 15905328..15905584 1501..1757 100 <- Minus
chr2L 15905094..15905265 1758..1929 100 <- Minus
chr2L 15904180..15904595 1930..2345 99 <- Minus
chr2L 15903924..15904130 2403..2610 98 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:41:02 Download gff for FI02157.complete
Subject Subject Range Query Range Percent Splice Strand
beat-Ib-RA 1..984 1083..2066 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:16:52 Download gff for FI02157.complete
Subject Subject Range Query Range Percent Splice Strand
beat-Ib-RB 1..984 1083..2066 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:43:25 Download gff for FI02157.complete
Subject Subject Range Query Range Percent Splice Strand
beat-Ib-RA 1..984 1083..2066 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:14:43 Download gff for FI02157.complete
Subject Subject Range Query Range Percent Splice Strand
beat-Ib-RA 1..984 1083..2066 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:41:01 Download gff for FI02157.complete
Subject Subject Range Query Range Percent Splice Strand
beat-Ib-RA 1..2600 2..2610 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:16:51 Download gff for FI02157.complete
Subject Subject Range Query Range Percent Splice Strand
beat-Ib-RB 1..2608 2..2610 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:43:25 Download gff for FI02157.complete
Subject Subject Range Query Range Percent Splice Strand
beat-Ib-RB 3..2611 1..2610 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-24 16:47:27 Download gff for FI02157.complete
Subject Subject Range Query Range Percent Splice Strand
beat-Ib-RA 1..2600 2..2610 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:14:43 Download gff for FI02157.complete
Subject Subject Range Query Range Percent Splice Strand
beat-Ib-RB 3..2611 1..2610 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:14:43 Download gff for FI02157.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15962001..15962432 1..433 99   Minus
2L 15939364..15940082 434..1152 100 <- Minus
2L 15908067..15908278 1153..1364 100 <- Minus
2L 15906864..15906999 1365..1500 100 <- Minus
2L 15906549..15906805 1501..1757 100 <- Minus
2L 15906318..15906489 1758..1929 100 <- Minus
2L 15905134..15905813 1930..2610 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:43:25 Download gff for FI02157.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15962001..15962432 1..433 99   Minus
arm_2L 15939364..15940082 434..1152 100 <- Minus
arm_2L 15908067..15908278 1153..1364 100 <- Minus
arm_2L 15906864..15906999 1365..1500 100 <- Minus
arm_2L 15906549..15906805 1501..1757 100 <- Minus
arm_2L 15906318..15906489 1758..1929 100 <- Minus
arm_2L 15905134..15905813 1930..2610 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:47:53 Download gff for FI02157.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15962001..15962432 1..433 99   Minus
2L 15939364..15940082 434..1152 100 <- Minus
2L 15908067..15908278 1153..1364 100 <- Minus
2L 15906864..15906999 1365..1500 100 <- Minus
2L 15906549..15906805 1501..1757 100 <- Minus
2L 15906318..15906489 1758..1929 100 <- Minus
2L 15905134..15905813 1930..2610 99 <- Minus

FI02157.pep Sequence

Translation from 1082 to 2065

> FI02157.pep
MQKPALKLRRLFIITAIYIASLPGLTVGLRNVNVRIPSAVKRGDNALLIC
NYDIENDTLYTVKWYRGRREFYRYTPKENPAWKIFTKTNEIDVETAQSNA
SHVLLRNVPTSISGKFACEVSADAPTFDTSIVAADMEVVELPTQRPIITG
IHSRYRLGDVINGNCSSDYSKPAANLTWWINDIQVPPNYLRIYDIQRHVA
EHLESAVLEIKFVVTVHHFIKSRLKLKCSARIHEIYAQESEKLIEEDRPR
ILASGRSPDMNMYPFDQPGDADEHNELFLIHSNAACGPFAWHPILFLLLW
PSFWVFAAWENWLWNLLEARLFGRAVR*

FI02157.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:52:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14966-PA 317 GF14966-PA 1..315 1..316 1440 84.5 Plus
Dana\GF14934-PA 454 GF14934-PA 54..341 22..302 850 53.5 Plus
Dana\GF14936-PA 424 GF14936-PA 23..246 25..249 622 51.6 Plus
Dana\GF15111-PA 362 GF15111-PA 7..246 12..250 456 39.8 Plus
Dana\GF16886-PA 428 GF16886-PA 51..246 12..227 429 42.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24184-PA 330 GG24184-PA 1..330 1..327 1665 94.5 Plus
Dere\GG25187-PA 550 GG25187-PA 54..341 23..302 834 52.8 Plus
Dere\GG25189-PA 431 GG25189-PA 23..243 25..246 618 51.8 Plus
Dere\GG21755-PA 361 GG21755-PA 5..246 11..250 433 39.5 Plus
Dere\GG16781-PA 429 GG16781-PA 68..236 29..194 403 48.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:52:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11350-PA 665 GH11350-PA 7..271 25..288 1304 90.9 Plus
Dgri\GH10393-PA 462 GH10393-PA 49..317 22..281 810 55.4 Plus
Dgri\GH10395-PA 348 GH10395-PA 1..202 47..249 559 50.2 Plus
Dgri\GH10085-PA 397 GH10085-PA 7..245 13..250 459 40.8 Plus
Dgri\GH11700-PA 270 GH11700-PA 2..217 32..248 389 36.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:52:11
Subject Length Description Subject Range Query Range Score Percent Strand
beat-Ib-PB 327 CG7644-PB 1..327 1..327 1741 100 Plus
beat-Ib-PA 327 CG7644-PA 1..327 1..327 1741 100 Plus
beat-Ic-PC 534 CG4838-PC 40..338 12..302 820 51.2 Plus
beat-Ic-PB 534 CG4838-PB 40..338 12..302 820 51.2 Plus
beat-Ic-PA 534 CG4838-PA 40..338 12..302 820 51.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:52:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12934-PA 279 GI12934-PA 1..278 6..283 1336 88.5 Plus
Dmoj\GI17370-PA 549 GI17370-PA 52..322 22..283 815 55.4 Plus
Dmoj\GI17373-PA 402 GI17373-PA 1..261 6..267 652 47.7 Plus
Dmoj\GI14269-PA 389 GI14269-PA 6..241 15..250 461 41.4 Plus
Dmoj\GI17146-PA 274 GI17146-PA 2..267 32..314 404 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:52:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15323-PA 351 GL15323-PA 1..307 1..319 1416 84.3 Plus
Dper\GL15307-PA 1184 GL15307-PA 64..258 22..218 645 57.4 Plus
Dper\GL21040-PA 402 GL21040-PA 6..258 25..274 623 47.6 Plus
Dper\GL22402-PA 342 GL22402-PA 7..230 27..250 442 41.8 Plus
Dper\GL22397-PA 270 GL22397-PA 2..217 32..248 397 37.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20502-PA 624 GA20502-PA 288..580 15..319 1344 83.6 Plus
Dpse\GA29045-PA 580 GA29045-PA 60..347 22..302 847 53.1 Plus
Dpse\GA18474-PA 402 GA18474-PA 6..258 25..274 624 47.6 Plus
Dpse\GA13521-PA 393 GA13521-PA 7..245 13..250 454 40.8 Plus
Dpse\GA11722-PA 270 GA11722-PA 2..217 32..248 397 37.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17922-PA 327 GM17922-PA 1..327 1..327 1727 98.2 Plus
Dsec\GM18650-PA 590 GM18650-PA 53..397 22..302 745 44.6 Plus
Dsec\GM18652-PA 429 GM18652-PA 23..243 25..246 622 52.3 Plus
Dsec\GM17137-PA 361 GM17137-PA 13..246 18..250 433 40 Plus
Dsec\GM17225-PA 270 GM17225-PA 4..266 34..314 410 33.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21931-PA 327 GD21931-PA 1..327 1..327 1731 98.5 Plus
Dsim\GD24036-PA 540 GD24036-PA 53..341 22..302 838 52.6 Plus
Dsim\GD24038-PA 429 GD24038-PA 12..243 14..246 629 51.1 Plus
Dsim\GD24100-PA 270 GD24100-PA 4..217 34..248 404 38.6 Plus
Dsim\GD20239-PA 431 GD20239-PA 66..236 27..194 403 48.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18188-PA 486 GJ18188-PA 216..463 73..324 952 73.8 Plus
Dvir\GJ18050-PA 568 GJ18050-PA 57..325 22..281 827 55.8 Plus
Dvir\GJ18052-PA 381 GJ18052-PA 7..248 25..267 639 49.8 Plus
Dvir\GJ16239-PA 416 GJ16239-PA 7..245 13..250 451 40.8 Plus
Dvir\GJ16186-PA 370 GJ16186-PA 91..313 25..248 406 37.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24261-PA 405 GK24261-PA 124..403 23..300 1333 87.9 Plus
Dwil\GK24768-PA 518 GK24768-PA 27..314 22..300 841 52.1 Plus
Dwil\GK18108-PA 411 GK18108-PA 15..248 19..249 632 51.9 Plus
Dwil\GK23873-PA 400 GK23873-PA 7..245 12..250 486 41.7 Plus
Dwil\GK23799-PA 259 GK23799-PA 4..217 34..248 392 37.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19377-PA 330 GE19377-PA 1..330 1..327 1685 95.5 Plus
Dyak\GE21288-PA 546 GE21288-PA 44..341 13..302 833 51 Plus
Dyak\GE21310-PA 427 GE21310-PA 23..243 25..246 620 51.8 Plus
Dyak\GE13146-PA 361 GE13146-PA 7..246 12..250 430 39 Plus
Dyak\GE12783-PA 317 GE12783-PA 49..289 5..248 407 36.5 Plus

FI02157.hyp Sequence

Translation from 1082 to 2065

> FI02157.hyp
MQKPALKLRRLFIITAIYIASLPGLTVGLRNVNVRIPSAVKRGDNALLIC
NYDIENDTLYTVKWYRGRREFYRYTPKENPAWKIFTKTNEIDVETAQSNA
SHVLLRNVPTSISGKFACEVSADAPTFDTSIVAADMEVVELPTQRPIITG
IHSRYRLGDVINGNCSSDYSKPAANLTWWINDIQVPPNYLRIYDIQRHVA
EHLESAVLEIKFVVTVHHFIKSRLKLKCSARIHEIYAQESEKLIEEDRPR
ILASGRSPDMNMYPFDQPGDADEHNELFLIHSNAACGPFAWHPILFLLLW
PSFWVFAAWENWLWNLLEARLFGRAVR*

FI02157.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
beat-Ib-PB 327 CG7644-PB 1..327 1..327 1741 100 Plus
beat-Ib-PA 327 CG7644-PA 1..327 1..327 1741 100 Plus
beat-Ic-PC 534 CG4838-PC 40..338 12..302 820 51.2 Plus
beat-Ic-PB 534 CG4838-PB 40..338 12..302 820 51.2 Plus
beat-Ic-PA 534 CG4838-PA 40..338 12..302 820 51.2 Plus