Clone FI02176 Report

Search the DGRC for FI02176

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:21
Well:76
Vector:pFlc-1
Associated Gene/TranscriptNT1-RB
Protein status:FI02176.pep: gold
Sequenced Size:2024

Clone Sequence Records

FI02176.complete Sequence

2024 bp assembled on 2010-01-25

GenBank Submission: BT120208.1

> FI02176.complete
AGTTTGCGGCGAGTGTTGAAAGCGTTCAGACGTAGCAGGCGGAAAAAATA
AAAAGCTGTCTCAAAAGCAAAACGAAGGTGAATGCCAAGCGGACAGACTC
AAGAAGTGTGGCAAAGTAGAAATTTCTGTTAATTAAGGCGCGTGTGAAAA
GTGTGAAAATCAGCGAAGGCGGTAGCCAATGAGCCTATAAAAGTGAAAAT
TATCTATGCAAAGTGGAGTGGAATGGAAACTCGGTCCTTGCGCCGCAACA
GGAAATAAACAGTGATCAAGCTAAATACATATATCGAAGCTCGGAAGACT
GGAGAAGGGAGTGGCTTGGAGAACAAAAAAAAAAAGAAGAACAGTGGACT
GAAGACAAGCTGATCTGAGGTGATTTCTGAAGCTCTGCTTTAGCTTTATA
AATTAATCATAAAAAACTAGAGCGCAAAGCGGAGAACAAGAAACAAAATC
GAAATTGGAATTTTAAAATAGCATTTCATTTACGACTGCAATTAAAAACA
AAGCCAAGAAAATAAAGCCAGAGTGAAAATGAAAGCTGGCCGCGCCTTCG
GCTGCCTTTTCTGGGCTCTGCTCTATTGTGTGCTCTATCTGGATCTGGTC
AGTGGGAACTCCGCCGACGATGAGCTGATGGACTTTGATTTTGCGGATTC
AAATGATGCTGCTATGGAGGACTGGCAGCTGGATGATCTGGAGGAGGCAA
AAAAGGCGGAGCAGGCCGAAAAGAAGTTGGAGTCGAATATGCTGGACTTT
AGCGTAGATCTGGATGAACCGGAGCCGGAGAAACAATTACCACCTTTCGA
TTGGCGAGAAAGGGTTTTAAGAAACGCTCTGGCCAAAGCCTTGGCGGATG
AGGGATTGCGCCAGAAGTTCGCCGAAGTTTTGCCCATTTTAAGAATGCTA
TCTTCTCAACAGCGCCTGGCTCTTTCCGCTTTGATCTCGGCTCAGATGAA
TGCAAAAAAGGGGCACGAACTAAAGTTTGAACAGGTTCGCATGATGTTTG
GCAATGAAAAAAAGCTGCTTTTGCCCATAGTGTTCGACATCGCAAATCTC
ATAAAGAGCTCTACCCGCAAGTACATCAATCTGGGTTCTGATCTGGCTTC
ATCTGCCCTTTACCATACTCCCATCAATCGTCGTGAAGATGATTTGACTC
CAGAAGAGTCCCAACAGGATGACCAATTGGGCACCATTGCTGTGGAAGTT
GAGCCAAAAAAGGTCTCTACTGAGGAGGTGCAATTGGAGTCTCTAGAGGA
CTTCTTTGATGAGATGGGGTCAGAAGTGCTTGATCCTCAGATGATCAATG
AGGCCCTGACAGGTGATCTTCATGATAACAAAACCAAGACTTTTAAACCA
GAAAATCATGGTCAAAGAGTTCGACGATCGGCAAACGAGTTTGTTCACAA
ATTGACCCGATCCGTGCCTGCTTCTGTGACCGAGCAGCAACTTTTGGGTG
GCATTGCTGGACGTACCATCAAGCTGAATACCACAGCTTTTCAACAGCCA
AGTAGCCAGGAGGAGGAGAAGATGGCCTCCTCCAATGGTGGCCAGTCATA
CTCTGAGGTGGAGGATCTGGCTTTTGCTGGTCTTAATGGCACGGAAATCC
CCCTGAGCGCTGATGAGCGATTAGATCTGCAAAGAAACAGCGCCGAGGAG
ACTGAGGAACCACTACCAAGTCCAGAGGAACTCATCGCTGGACCACGTTA
CCGACTGGGGAAAAGACCACTGCCTGGTCAAAAATCTGGATCTCCCATCA
AACGAAAGAGAGTCACATCCTCCTTAAGGGGAAGACCGAAGACCGCCGCC
AGTTCCCATAAACCCGTGGTTACACCACCCAACAAGAAATGCGAACGATT
CACCAGCAACATGTGCATCCGAACCGACGACTATCCGCTGTAAGATTCCC
GTAGCTAGTTGGTGAGCGGTACTCCCAGGGTCCTGGTTCCGGTCCATAGT
CCTTAGCTCTAGTTTAGTCCGAATTTTAGCCATAATAAAACTTTAATTTA
TGAATCACAAAAAAAAAAAAAAAA

FI02176.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
spz2-RB 2008 spz2-RB 1..2008 1..2008 10025 99.9 Plus
spz2-RE 1907 spz2-RE 379..1906 482..2009 7640 100 Plus
spz2-RF 3869 spz2-RF 370..1777 482..1889 7040 100 Plus
spz2-RE 1907 spz2-RE 10..378 1..369 1830 99.7 Plus
spz2-RF 3869 spz2-RF 1..369 1..369 1830 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4503640..4504666 2008..982 5135 100 Minus
chr3L 24539361 chr3L 4504753..4505257 986..482 2525 100 Minus
chr3L 24539361 chr3L 4507304..4507784 481..1 2390 99.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
NT1-RE 1365 CG42576-PE 1..1365 529..1893 6825 100 Plus
NT1-RB 1365 CG42576-PB 1..1365 529..1893 6825 100 Plus
NT1-RC 1365 CG42576-PC 1..1365 529..1893 6825 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:07 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
NT1-RB 2012 CG42576-RB 5..2012 1..2008 10025 100 Plus
NT1-RG 3985 CG42576-RG 5..1893 1..1889 9430 99.9 Plus
NT1-RE 1900 CG42576-RE 374..1900 482..2008 7635 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
NT1-PE 454 CG42576-PE 1..454 529..1890 2083 100 Plus
NT1-PB 454 CG42576-PB 1..454 529..1890 2083 100 Plus
NT1-PC 454 CG42576-PC 1..454 529..1890 2083 100 Plus
NT1-PD 886 CG42576-PD 1..454 529..1890 2083 100 Plus
NT1-PH 1042 CG42576-PH 1..454 529..1890 2083 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4504284..4505311 2009..982 5140 100 Minus
3L 28110227 3L 4505398..4505902 986..482 2525 100 Minus
3L 28110227 3L 4507949..4508429 481..1 2390 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4504284..4505311 2009..982 5140 100 Minus
3L 28103327 3L 4505398..4505902 986..482 2525 100 Minus
3L 28103327 3L 4507949..4508429 481..1 2390 99.7 Minus
Blast to na_te.dros performed on 2014-11-27 08:56:44 has no hits.

FI02176.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:34:57 Download gff for FI02176.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4507304..4507784 1..481 99   Minus
chr3L 4504755..4505257 482..984 100 <- Minus
chr3L 4503640..4504663 985..2008 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-25 16:49:07 Download gff for FI02176.complete
Subject Subject Range Query Range Percent Splice Strand
CG32244-RC 1..1365 529..1893 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:54:22 Download gff for FI02176.complete
Subject Subject Range Query Range Percent Splice Strand
NT1-RE 1..1365 529..1893 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:20:41 Download gff for FI02176.complete
Subject Subject Range Query Range Percent Splice Strand
NT1-RC 1..1365 529..1893 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:34:57 Download gff for FI02176.complete
Subject Subject Range Query Range Percent Splice Strand
NT1-RC 1..1365 529..1893 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-25 16:49:07 Download gff for FI02176.complete
Subject Subject Range Query Range Percent Splice Strand
CG32244-RB 1..2008 1..2008 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:54:22 Download gff for FI02176.complete
Subject Subject Range Query Range Percent Splice Strand
NT1-RB 1..2008 1..2008 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:20:41 Download gff for FI02176.complete
Subject Subject Range Query Range Percent Splice Strand
NT1-RB 5..2012 1..2008 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:34:57 Download gff for FI02176.complete
Subject Subject Range Query Range Percent Splice Strand
NT1-RB 5..2012 1..2008 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:34:57 Download gff for FI02176.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4507949..4508429 1..481 99   Minus
3L 4505400..4505902 482..984 100 <- Minus
3L 4504285..4505308 985..2008 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:20:41 Download gff for FI02176.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4507949..4508429 1..481 99   Minus
arm_3L 4505400..4505902 482..984 100 <- Minus
arm_3L 4504285..4505308 985..2008 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:30:47 Download gff for FI02176.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4507949..4508429 1..481 99   Minus
3L 4505400..4505902 482..984 100 <- Minus
3L 4504285..4505308 985..2008 100 <- Minus

FI02176.pep Sequence

Translation from 528 to 1892

> FI02176.pep
MKAGRAFGCLFWALLYCVLYLDLVSGNSADDELMDFDFADSNDAAMEDWQ
LDDLEEAKKAEQAEKKLESNMLDFSVDLDEPEPEKQLPPFDWRERVLRNA
LAKALADEGLRQKFAEVLPILRMLSSQQRLALSALISAQMNAKKGHELKF
EQVRMMFGNEKKLLLPIVFDIANLIKSSTRKYINLGSDLASSALYHTPIN
RREDDLTPEESQQDDQLGTIAVEVEPKKVSTEEVQLESLEDFFDEMGSEV
LDPQMINEALTGDLHDNKTKTFKPENHGQRVRRSANEFVHKLTRSVPASV
TEQQLLGGIAGRTIKLNTTAFQQPSSQEEEKMASSNGGQSYSEVEDLAFA
GLNGTEIPLSADERLDLQRNSAEETEEPLPSPEELIAGPRYRLGKRPLPG
QKSGSPIKRKRVTSSLRGRPKTAASSHKPVVTPPNKKCERFTSNMCIRTD
DYPL*

FI02176.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24726-PA 455 GF24726-PA 1..455 1..454 1758 76.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14177-PA 455 GG14177-PA 1..455 1..454 2235 92.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:33:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15802-PA 458 GH15802-PA 1..458 1..454 1459 64.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
NT1-PH 1042 CG42576-PH 1..454 1..454 2317 100 Plus
NT1-PG 1042 CG42576-PG 1..454 1..454 2317 100 Plus
NT1-PE 454 CG42576-PE 1..454 1..454 2317 100 Plus
NT1-PD 886 CG42576-PD 1..454 1..454 2317 100 Plus
NT1-PB 454 CG42576-PB 1..454 1..454 2317 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12585-PA 456 GI12585-PA 1..456 1..454 1531 67.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17944-PA 452 GL17944-PA 1..452 1..454 1516 67.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16783-PA 452 GA16783-PA 1..452 1..454 1639 71.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13966-PA 458 GM13966-PA 1..437 1..437 2195 95 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13249-PA 454 GD13249-PA 1..454 1..454 2346 96.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15491-PA 447 GJ15491-PA 1..447 1..454 1469 65.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17607-PA 436 GK17607-PA 5..436 9..454 1460 66.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20604-PA 454 GE20604-PA 1..454 1..454 2236 92.7 Plus

FI02176.hyp Sequence

Translation from 528 to 1892

> FI02176.hyp
MKAGRAFGCLFWALLYCVLYLDLVSGNSADDELMDFDFADSNDAAMEDWQ
LDDLEEAKKAEQAEKKLESNMLDFSVDLDEPEPEKQLPPFDWRERVLRNA
LAKALADEGLRQKFAEVLPILRMLSSQQRLALSALISAQMNAKKGHELKF
EQVRMMFGNEKKLLLPIVFDIANLIKSSTRKYINLGSDLASSALYHTPIN
RREDDLTPEESQQDDQLGTIAVEVEPKKVSTEEVQLESLEDFFDEMGSEV
LDPQMINEALTGDLHDNKTKTFKPENHGQRVRRSANEFVHKLTRSVPASV
TEQQLLGGIAGRTIKLNTTAFQQPSSQEEEKMASSNGGQSYSEVEDLAFA
GLNGTEIPLSADERLDLQRNSAEETEEPLPSPEELIAGPRYRLGKRPLPG
QKSGSPIKRKRVTSSLRGRPKTAASSHKPVVTPPNKKCERFTSNMCIRTD
DYPL*

FI02176.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
NT1-PH 1042 CG42576-PH 1..454 1..454 2317 100 Plus
NT1-PG 1042 CG42576-PG 1..454 1..454 2317 100 Plus
NT1-PE 454 CG42576-PE 1..454 1..454 2317 100 Plus
NT1-PD 886 CG42576-PD 1..454 1..454 2317 100 Plus
NT1-PB 454 CG42576-PB 1..454 1..454 2317 100 Plus