Clone FI02182 Report

Search the DGRC for FI02182

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:21
Well:82
Vector:pFlc-1
Associated Gene/TranscriptYp3-RA
Protein status:FI02182.pep: gold
Sequenced Size:1505

Clone Sequence Records

FI02182.complete Sequence

1505 bp assembled on 2010-01-26

GenBank Submission: BT120217.1

> FI02182.complete
GATCAAACGTCGTTTAGCGTTTGGCCTGATCTGATTCAATTCCGGATTTG
CACCAAAATGATGAGTCTAAGGATTTGCCTGCTGGCCACCTGCCTCCTGG
TGGCGGCCCATGCCTCCAAGGATGCCTCCAATGACCGACTGAAGCCGACC
AAGTGGCTGACCGCCACCGAGCTGGAGAACGTGCCCTCCCTCAACGACAT
CACCTGGGAGCGTTTGGAGAATCAGCCGCTGGAGCAGGGCGCCAAGGTGA
TCGAGAAGATCTACCACGTTGGCCAAATCAAGCACGATCTGACCCCCAGC
TTTGTGCCCAGCCCGAGCAATGTGCCCGTCTGGATTATCAAGTCCAATGG
ACAGAAGGTTGAGTGCAAGTTGAACAACTATGTGGAGACGGCCAAGGCAC
AGCCCGGATTCGGCGAGGATGAGGTCACCATTGTCCTGACTGGTCTGCCC
AAGACCAGCCCCGCTCAGCAGAAGGCCATGCGCAGGTTGATCCAGGCCTA
CGTCCAGAAGTACAACCTCCAGCAGCTGCAGAAGAACGCCCAGGAGCAGC
AGCAGCAGCTCAAGAGCAGCGACTACGACTACACCAGCAGCGAGGAGGCC
GCTGACCAATGGAAATCCGCCAAGGCTGCCAGCGGCGATTTGATCATCAT
TGACCTCGGCTCCACCCTGACCAACTTCAAACGCTACGCGATGCTGGATG
TTCTGAACACCGGCGCCATGATCGGCCAGACCCTGATCGATCTGACCAAC
AAGGGTGTGCCCCAGGAGATCATCCATCTGATCGGCCAGGGAATCAGCGC
CCATGTGGCCGGAGCTGCTGGCAACAAGTACACCGCCCAAACCGGACACA
AGCTGCGCCGCATCACCGGTCTGGATCCCGCCAAGGTGCTGTCCAAGCGT
CCCCAGATCCTGGGTGGTCTGTCCCGCGGCGATGCTGACTTCGTTGATGC
CATTCACACATCGACCTTCGCCATGGGCACGCCCATCCGTTGCGGCGATG
TTGACTTCTACCCCAACGGACCGTCCACCGGTGTTCCCGGCTCCGAGAAT
GTGATCGAGGCTGTGGCCCGTGCCACCCGTTACTTTGCCGAGTCTGTGCG
TCCCGGTAGCGAGCGCAATTTCCCCGCCGTTCCGGCCAACTCGCTGAAGC
AGTACAAGGAGCAGGATGGCTTTGGCAAGCGCGCCTACATGGGTCTCCAG
ATCGACTACGATCTGCGCGGTGACTACATCTTGGAGGTCAACGCCAAGAG
CCCCTTCGGTCAGCGCAGCCCTGCCCACAAGCAGGCCGCCTACCATGGCA
TGCACCACGCCCAGAACTAGAGCGCCCATGGCCACGCCCCCTGGTTACCA
GGGACGTTCGATCGTCACGCACTTTCTGATAATCAGAAAATAAAAACCCG
GAATGCGTAGTTTAGCTTAGAAGTTTCATCAAACAATCAAAAAAGAAAAA
TCTATAAAATCCCATAAAAATAAAAGCTGCAAATTTTCGAAAAAAAAAAA
AAAAA

FI02182.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
Yp3-RA 1804 Yp3-RA 205..1696 2..1493 7460 100 Plus
Yp1-RA 1700 Yp1-RA 1237..1416 1069..1248 360 80 Plus
Yp1.b 1906 Yp1.b 1443..1622 1069..1248 360 80 Plus
Yp1-RA 1700 Yp1-RA 1084..1208 916..1040 325 84 Plus
Yp1.b 1906 Yp1.b 1290..1414 916..1040 325 84 Plus
Yp1-RA 1700 Yp1-RA 1009..1053 841..885 180 93.3 Plus
Yp1.b 1906 Yp1.b 1215..1259 841..885 180 93.3 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:58:18
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13651054..13651897 646..1489 4220 100 Plus
chrX 22417052 chrX 13650599..13650981 263..645 1915 100 Plus
chrX 22417052 chrX 13650276..13650536 2..262 1305 100 Plus
chrX 22417052 chrX 9946431..9946838 841..1248 720 78.4 Plus
chrX 22417052 chrX 9942869..9943407 1295..757 505 72.9 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
Yp3-RB 1263 CG11129-PB 1..1263 58..1320 6315 100 Plus
Yp3-RA 1263 CG11129-PA 1..1263 58..1320 6315 100 Plus
Yp1-RB 1320 CG2985-PB 814..1221 841..1248 720 78.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:10 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
Yp3-RB 1868 CG11129-RB 1..1488 2..1489 7440 100 Plus
Yp3-RA 1488 CG11129-RA 1..1488 2..1489 7440 100 Plus
Yp1-RB 1611 CG2985-RB 920..1327 841..1248 720 78.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
Yp3-PB 420 CG11129-PB 1..420 58..1317 2015 100 Plus
Yp3-PA 420 CG11129-PA 1..420 58..1317 2015 100 Plus
Yp1-PB 439 CG2985-PB 1..430 58..1317 1153 53.1 Plus
Yp1-PA 439 CG2985-PA 1..430 58..1317 1153 53.1 Plus
Yp2-PB 442 CG2979-PB 1..427 58..1305 1033 48.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13760324..13761171 646..1493 4240 100 Plus
X 23542271 X 13759869..13760251 263..645 1915 100 Plus
X 23542271 X 13759546..13759806 2..262 1305 100 Plus
X 23542271 X 10054807..10055214 841..1248 720 78.4 Plus
X 23542271 X 10051245..10051783 1295..757 520 73.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13768422..13769269 646..1493 4240 100 Plus
X 23527363 X 13767967..13768349 263..645 1915 100 Plus
X 23527363 X 13767644..13767904 2..262 1305 100 Plus
X 23527363 X 10063133..10063312 1069..1248 360 80 Plus
X 23527363 X 10062980..10063104 916..1040 325 84 Plus
X 23527363 X 10059343..10059569 1295..1069 310 75.7 Minus
X 23527363 X 10062905..10062949 841..885 180 93.3 Plus
X 23527363 X 10059661..10059719 977..919 160 84.7 Minus
X 23527363 X 10059759..10059839 879..799 150 79 Minus
Blast to na_te.dros performed on 2014-11-27 05:58:13 has no hits.

FI02182.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:47:05 Download gff for FI02182.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13651054..13651897 646..1489 100   Plus
chrX 13650599..13650981 263..645 100 -> Plus
chrX 13650275..13650536 1..262 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-26 19:38:59 Download gff for FI02182.complete
Subject Subject Range Query Range Percent Splice Strand
Yp3-RA 1..1263 58..1320 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:08:29 Download gff for FI02182.complete
Subject Subject Range Query Range Percent Splice Strand
Yp3-RA 1..1263 58..1320 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:41:19 Download gff for FI02182.complete
Subject Subject Range Query Range Percent Splice Strand
Yp3-RA 1..1263 58..1320 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:47:05 Download gff for FI02182.complete
Subject Subject Range Query Range Percent Splice Strand
Yp3-RA 1..1263 58..1320 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-26 19:38:49 Download gff for FI02182.complete
Subject Subject Range Query Range Percent Splice Strand
Yp3-RA 2..1489 2..1489 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:08:29 Download gff for FI02182.complete
Subject Subject Range Query Range Percent Splice Strand
Yp3-RA 2..1489 2..1489 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:41:19 Download gff for FI02182.complete
Subject Subject Range Query Range Percent Splice Strand
Yp3-RA 2..1489 2..1489 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:47:05 Download gff for FI02182.complete
Subject Subject Range Query Range Percent Splice Strand
Yp3-RA 1..1488 2..1489 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:47:05 Download gff for FI02182.complete
Subject Subject Range Query Range Percent Splice Strand
X 13760324..13761167 646..1489 100   Plus
X 13759869..13760251 263..645 100 -> Plus
X 13759545..13759806 1..262 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:41:19 Download gff for FI02182.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13654357..13655200 646..1489 100   Plus
arm_X 13653902..13654284 263..645 100 -> Plus
arm_X 13653578..13653839 1..262 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:00:41 Download gff for FI02182.complete
Subject Subject Range Query Range Percent Splice Strand
X 13768422..13769265 646..1489 100   Plus
X 13767967..13768349 263..645 100 -> Plus
X 13767643..13767904 1..262 99 -> Plus

FI02182.pep Sequence

Translation from 0 to 1319

> FI02182.pep
DQTSFSVWPDLIQFRICTKMMSLRICLLATCLLVAAHASKDASNDRLKPT
KWLTATELENVPSLNDITWERLENQPLEQGAKVIEKIYHVGQIKHDLTPS
FVPSPSNVPVWIIKSNGQKVECKLNNYVETAKAQPGFGEDEVTIVLTGLP
KTSPAQQKAMRRLIQAYVQKYNLQQLQKNAQEQQQQLKSSDYDYTSSEEA
ADQWKSAKAASGDLIIIDLGSTLTNFKRYAMLDVLNTGAMIGQTLIDLTN
KGVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKR
PQILGGLSRGDADFVDAIHTSTFAMGTPIRCGDVDFYPNGPSTGVPGSEN
VIEAVARATRYFAESVRPGSERNFPAVPANSLKQYKEQDGFGKRAYMGLQ
IDYDLRGDYILEVNAKSPFGQRSPAHKQAAYHGMHHAQN*

FI02182.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22605-PA 433 GF22605-PA 1..370 21..390 1581 85.1 Plus
Dana\GF19155-PA 436 GF19155-PA 33..425 47..436 1197 56.2 Plus
Dana\GF19151-PA 428 GF19151-PA 5..415 19..436 1129 50.1 Plus
Dana\GF22327-PA 420 GF22327-PA 171..377 213..420 364 38.5 Plus
Dana\GF10332-PA 333 GF10332-PA 106..316 213..423 345 37.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17811-PA 420 GG17811-PA 1..420 20..439 2072 92.4 Plus
Dere\GG18339-PA 439 GG18339-PA 27..430 41..439 1184 55.4 Plus
Dere\GG18948-PA 459 GG18948-PA 9..445 11..436 1097 47.1 Plus
Dere\GG19106-PA 411 GG19106-PA 144..379 195..429 382 36.7 Plus
Dere\GG16105-PA 376 GG16105-PA 150..360 213..423 346 38.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12799-PA 414 GH12799-PA 1..413 21..437 1553 70.1 Plus
Dgri\Yp1-PA 433 GH11817-PA 1..426 20..437 1228 53.9 Plus
Dgri\Yp2-PA 440 GH12905-PA 7..424 25..437 1141 48.8 Plus
Dgri\GH12060-PA 391 GH12060-PA 155..377 202..423 377 37.9 Plus
Dgri\GH14732-PA 333 GH14732-PA 104..327 213..436 310 33.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
Yp3-PB 420 CG11129-PB 1..420 20..439 2178 100 Plus
Yp3-PA 420 CG11129-PA 1..420 20..439 2178 100 Plus
Yp1-PB 439 CG2985-PB 1..430 20..439 1228 54.6 Plus
Yp1-PA 439 CG2985-PA 1..430 20..439 1228 54.6 Plus
Yp2-PB 442 CG2979-PB 1..427 20..435 1099 49.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15954-PA 411 GI15954-PA 18..409 43..436 1571 72.1 Plus
Dmoj\GI16001-PA 432 GI16001-PA 1..425 20..437 1223 54.6 Plus
Dmoj\GI14609-PA 299 GI14609-PA 12..291 26..307 618 42.8 Plus
Dmoj\GI14610-PA 124 GI14610-PA 1..113 325..437 422 62.8 Plus
Dmoj\GI15548-PA 389 GI15548-PA 146..379 197..429 387 36.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:38:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19869-PA 428 GL19869-PA 16..428 36..439 1731 81.1 Plus
Dper\GL16391-PA 414 GL16391-PA 1..405 20..437 997 46.7 Plus
Dper\GL19879-PA 419 GL19879-PA 159..388 195..423 366 36.4 Plus
Dper\GL16592-PA 218 GL16592-PA 22..202 20..190 342 38.7 Plus
Dper\GL25135-PA 359 GL25135-PA 131..343 213..423 338 37.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10778-PA 428 GA10778-PA 16..428 36..439 1731 81.1 Plus
Dpse\GA15558-PA 434 GA15558-PA 1..425 20..437 1234 52.8 Plus
Dpse\GA22302-PA 442 GA22302-PA 1..428 20..437 1154 50.8 Plus
Dpse\GA18700-PA 419 GA18700-PA 159..388 195..423 366 36.4 Plus
Dpse\GA19044-PA 359 GA19044-PA 131..343 213..423 340 37.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17639-PA 420 GM17639-PA 1..420 20..439 2070 94.8 Plus
Dsec\GM11404-PA 439 GM11404-PA 27..430 41..439 1124 53.8 Plus
Dsec\Yp2-PA 442 GM11339-PA 9..428 11..436 1076 47 Plus
Dsec\GM22281-PA 376 GM22281-PA 102..360 168..423 328 33.1 Plus
Dsec\GM21737-PA 394 GM21737-PA 93..339 188..426 263 34.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16970-PA 439 GD16970-PA 27..430 41..439 1180 55 Plus
Dsim\Yp2-PA 459 GD16043-PA 9..445 11..436 1136 49.3 Plus
Dsim\GD17338-PA 249 GD17338-PA 44..242 213..412 338 38 Plus
Dsim\GD14879-PA 376 GD14879-PA 147..360 210..423 329 36.7 Plus
Dsim\GD11231-PA 394 GD11231-PA 101..339 196..426 261 35.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18846-PA 412 GJ18846-PA 18..410 43..436 1665 75.9 Plus
Dvir\Yp1-PA 432 GJ18728-PA 1..425 20..437 1227 55 Plus
Dvir\GJ19423-PA 431 GJ19423-PA 12..421 26..437 1154 51.4 Plus
Dvir\GJ14891-PA 392 GJ14891-PA 150..381 199..429 380 37.3 Plus
Dvir\GJ11509-PA 289 GJ11509-PA 60..267 213..421 324 36.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10125-PA 411 GK10125-PA 1..408 21..435 1753 77.1 Plus
Dwil\GK25831-PA 434 GK25831-PA 35..425 47..437 1231 57.6 Plus
Dwil\GK25110-PA 433 GK25110-PA 1..423 20..437 1104 50.6 Plus
Dwil\GK25805-PA 392 GK25805-PA 149..383 198..431 363 34.7 Plus
Dwil\GK16955-PA 292 GK16955-PA 60..270 213..421 306 36.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17107-PA 419 GE17107-PA 1..419 21..439 2138 95.2 Plus
Dyak\GE17827-PA 439 GE17827-PA 27..430 41..439 1162 53.8 Plus
Dyak\GE15420-PA 461 GE15420-PA 9..445 11..436 1112 48.4 Plus
Dyak\GE17652-PA 412 GE17652-PA 149..381 198..429 383 36.8 Plus
Dyak\GE19670-PA 376 GE19670-PA 150..360 213..423 331 36.8 Plus

FI02182.hyp Sequence

Translation from 1 to 1319

> FI02182.hyp
HQTSFSVWPDLIQFRICTKMMSLRICLLATCLLVAAHASKDASNDRLKPT
KWLTATELENVPSLNDITWERLENQPLEQGAKVIEKIYHVGQIKHDLTPS
FVPSPSNVPVWIIKSNGQKVECKLNNYVETAKAQPGFGEDEVTIVLTGLP
KTSPAQQKAMRRLIQAYVQKYNLQQLQKNAQEQQQQLKSSDYDYTSSEEA
ADQWKSAKAASGDLIIIDLGSTLTNFKRYAMLDVLNTGAMIGQTLIDLTN
KGVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKR
PQILGGLSRGDADFVDAIHTSTFAMGTPIRCGDVDFYPNGPSTGVPGSEN
VIEAVARATRYFAESVRPGSERNFPAVPANSLKQYKEQDGFGKRAYMGLQ
IDYDLRGDYILEVNAKSPFGQRSPAHKQAAYHGMHHAQN*

FI02182.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Yp3-PB 420 CG11129-PB 1..420 20..439 2178 100 Plus
Yp3-PA 420 CG11129-PA 1..420 20..439 2178 100 Plus
Yp1-PB 439 CG2985-PB 1..430 20..439 1228 54.6 Plus
Yp1-PA 439 CG2985-PA 1..430 20..439 1228 54.6 Plus
Yp2-PB 442 CG2979-PB 1..427 20..435 1099 49.7 Plus