Clone FI02802 Report

Search the DGRC for FI02802

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:2
Vector:pFlc-1
Associated Gene/TranscriptECSIT-RA
Protein status:FI02802.pep: gold
Sequenced Size:1346

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
ECSIT 2008-12-18 5.12 accounting

Clone Sequence Records

FI02802.complete Sequence

1346 bp assembled on 2008-11-04

GenBank Submission: BT050437.1

> FI02802.complete
GCAAAACGCGAACTAGTTCCGCAGCTTGTGCAATGTTTTGTAATCGTATT
TGCAAATTTATTCAATTAATTAATTATAAATAAAAAATGCTGCGCCGCGC
ACAATGCCTGCTCCGGCTGCACGGCAATGGAGGCCATTCGCTGGTCAGCC
GCTTTCGAAACTACGCTACGGACGAGGGAAATCCGAAACAGAACCCGAAT
CCAAATCCCAGGGCACAAAAACCCGGCACCAAAAACCTGCCGGCTTTAAG
GAACCCCTTTGCCGCCGCCCAGGACAGGACGAAAAACAGCTACCTGACCA
TGGTGGAGATATTCCAGGAGCGCGACGTCCACCGTCGGAACCATGTGGAG
TTCATCTACGCGGCACTCAAGAATATGGCGGATTTCGGGGTGGAAAGAGA
CTTGGAGGTCTACAAGGCCCTGATCAACGTGATGCCCAAGGGCAAGTTCA
TACCCACCAACATGTTCCAGGCAGAGTTCATGCACTACCCCAAACAGCAG
CAGTGTATCATTGATCTGCTTGAGCAGATGGAAGATTGCGGGGTGATGCC
CGATCACGAGATGGAGGCGATGCTGCTTAATGTGTTTGGCAGGCAGGGAC
ATCCACTGCGCAAGTATTGGCGCATGATGTACTGGATGCCAAAGTTTAAG
AACCTATCACCGTGGCCACTGCCCGATCCTGTTCCGGATGATACATTGGA
AATGGCCAAGCTGGCGCTAGAGCGGATGTGCACGGTCGACCTGCGGTCCA
AAATCACGGTTTTCGAGACCAGCGAGCTGAAGGATGCCATTGACGATACG
TGGATCGTGAGCGGAATGAGTCCCGAGCAGGAGAAACTGCTGCGGGAGCA
CTCTCGCCAGAAAGCTCTGTACATCGAGGGACCCTTTCACATATGGCTTA
GGAATCGCCGGATCAACTACTTTACCCTGCGCGCTGATGCAGATTCTGAG
TTCCTGTCTGAATTAGATGAGCGGCAGCTGGACGAGGACGATGTCTCCCA
CATCGAAGTACCCTTCTTTGGTCGTGCTCCACCAAGGCGACACAACCAGC
TGGGAAAGCTGCGCTCTGTCCACCAACAGGACGACGGAACCATTATGGCC
ATCTGTGCCACAGGCACCTCCACAAAGGACTCATTGCTCTCGTGGATTCG
CCTGTTGGAAGCGAACGGAAATCCCTCCATAGGAGAGGTGCCCGTCCTCT
TCCGGTTCACATCCGAAGTGCCAGCCAAGGCGGAGGAAATTGAAGGTGGC
GCCAGTGTCCCGGCAACAAGTGATAACAGTAGTCAAGATGAGCACATTAG
CAGTAGACAGAAATAAACAAATTGTTGAGCAAAAAAAAAAAAAAAA

FI02802.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
ECSIT-RA 1330 ECSIT-RA 1..1330 1..1330 6650 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1682231..1683560 1..1330 6650 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
ECSIT-RA 1230 CG10610-PA 1..1230 87..1316 6150 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:16 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
ECSIT-RA 1330 CG10610-RA 1..1330 1..1330 6650 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
ECSIT-PA 409 CG10610-PA 1..409 87..1313 2169 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5856585..5857915 1..1331 6655 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5597416..5598746 1..1331 6655 100 Plus
Blast to na_te.dros performed 2014-11-27 09:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy5 7369 gypsy5 GYPSY5 7369bp 541..582 46..87 111 73.8 Plus

FI02802.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:31:54 Download gff for FI02802.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1682231..1683560 1..1330 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:40:14 Download gff for FI02802.complete
Subject Subject Range Query Range Percent Splice Strand
ECSIT-RA 1..1230 87..1316 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:17:57 Download gff for FI02802.complete
Subject Subject Range Query Range Percent Splice Strand
ECSIT-RA 1..1230 87..1316 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:35:41 Download gff for FI02802.complete
Subject Subject Range Query Range Percent Splice Strand
ECSIT-RA 1..1230 87..1316 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:31:54 Download gff for FI02802.complete
Subject Subject Range Query Range Percent Splice Strand
ECSIT-RA 1..1230 87..1316 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:58:08 Download gff for FI02802.complete
Subject Subject Range Query Range Percent Splice Strand
ECSIT-RA 1..1330 1..1330 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:17:57 Download gff for FI02802.complete
Subject Subject Range Query Range Percent Splice Strand
ECSIT-RA 1..1330 1..1330 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:35:41 Download gff for FI02802.complete
Subject Subject Range Query Range Percent Splice Strand
ECSIT-RA 1..1330 1..1330 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 11:05:32 Download gff for FI02802.complete
Subject Subject Range Query Range Percent Splice Strand
ECSIT-RA 1..1330 1..1330 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:31:54 Download gff for FI02802.complete
Subject Subject Range Query Range Percent Splice Strand
ECSIT-RA 1..1330 1..1330 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:31:54 Download gff for FI02802.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5856585..5857914 1..1330 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:35:41 Download gff for FI02802.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1682307..1683636 1..1330 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:49:07 Download gff for FI02802.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5597416..5598745 1..1330 100   Plus

FI02802.pep Sequence

Translation from 86 to 1315

> FI02802.pep
MLRRAQCLLRLHGNGGHSLVSRFRNYATDEGNPKQNPNPNPRAQKPGTKN
LPALRNPFAAAQDRTKNSYLTMVEIFQERDVHRRNHVEFIYAALKNMADF
GVERDLEVYKALINVMPKGKFIPTNMFQAEFMHYPKQQQCIIDLLEQMED
CGVMPDHEMEAMLLNVFGRQGHPLRKYWRMMYWMPKFKNLSPWPLPDPVP
DDTLEMAKLALERMCTVDLRSKITVFETSELKDAIDDTWIVSGMSPEQEK
LLREHSRQKALYIEGPFHIWLRNRRINYFTLRADADSEFLSELDERQLDE
DDVSHIEVPFFGRAPPRRHNQLGKLRSVHQQDDGTIMAICATGTSTKDSL
LSWIRLLEANGNPSIGEVPVLFRFTSEVPAKAEEIEGGASVPATSDNSSQ
DEHISSRQK*

FI02802.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16367-PA 406 GF16367-PA 1..395 1..397 1942 89.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:56:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13098-PA 409 GG13098-PA 1..409 1..409 2081 93.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18888-PA 427 GH18888-PA 1..423 1..406 1736 77.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
ECSIT-PA 409 CG10610-PA 1..409 1..409 2169 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24745-PA 398 GI24745-PA 11..397 25..407 1713 82.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24040-PA 403 GL24040-PA 1..366 1..359 1646 83.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10436-PA 418 GA10436-PA 1..401 1..394 1805 83.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10851-PA 410 GM10851-PA 1..410 1..409 2082 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19834-PA 409 GD19834-PA 1..409 1..409 2179 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14572-PA 639 GJ14572-PA 244..638 18..407 1697 79 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:56:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13023-PA 400 GK13023-PA 1..400 1..398 1749 81 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10176-PA 409 GE10176-PA 1..409 1..409 2118 95.4 Plus

FI02802.hyp Sequence

Translation from 86 to 1315

> FI02802.hyp
MLRRAQCLLRLHGNGGHSLVSRFRNYATDEGNPKQNPNPNPRAQKPGTKN
LPALRNPFAAAQDRTKNSYLTMVEIFQERDVHRRNHVEFIYAALKNMADF
GVERDLEVYKALINVMPKGKFIPTNMFQAEFMHYPKQQQCIIDLLEQMED
CGVMPDHEMEAMLLNVFGRQGHPLRKYWRMMYWMPKFKNLSPWPLPDPVP
DDTLEMAKLALERMCTVDLRSKITVFETSELKDAIDDTWIVSGMSPEQEK
LLREHSRQKALYIEGPFHIWLRNRRINYFTLRADADSEFLSELDERQLDE
DDVSHIEVPFFGRAPPRRHNQLGKLRSVHQQDDGTIMAICATGTSTKDSL
LSWIRLLEANGNPSIGEVPVLFRFTSEVPAKAEEIEGGASVPATSDNSSQ
DEHISSRQK*

FI02802.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
ECSIT-PA 409 CG10610-PA 1..409 1..409 2169 100 Plus