Clone FI02804 Report

Search the DGRC for FI02804

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:4
Vector:pFlc-1
Associated Gene/TranscriptCG10628-RA
Protein status:FI02804.pep: gold
Sequenced Size:1267

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10628 2008-12-18 5.12 accounting

Clone Sequence Records

FI02804.complete Sequence

1267 bp assembled on 2008-12-04

GenBank Submission: BT053673.1

> FI02804.complete
GGCGGTCTGCTCATCGCTATTGTATAATGCCGCCTGCGCGATGGTGCAAA
TCTTTAAATTCCTGTTAAAATCCAGCAAATCTACCGGTCGTGCCCACTTC
CGGCCCACTTTTCTGGACACACTGCGCCTAGCGGTTCGTGGAGGACATGG
TGGAAATGGACTGCCCAAATACGGAGGAGTTGGTGGCCAAGGCGGTTGCG
TCTACTTGGTGGCAAAGGAAGGACTCACCCTTCGCAAGGTCGTCCAGGGA
TTGAAGGATAAGCGAGTGGCAGCATCCAGTGGCGAGGACAGTAGCAAAGC
CAGCATCTTTGGACGCCGTGGAGCTGACCAGAGGATCGAGGTGCCTGTGG
GCGTCCAGGTATATGACGACCAACAAAAACTCATCGCCGACCTCGACGAG
CACGAGGCGACATGCATTGTGGCGGGCGGAGGTACTGGCGGATGCACGGC
CACAAATTTTCTGGGACGTCCCGGGGAGAATCGCACTGTAAATCTGGACC
TAAAGCTAATAGCAGATGTGGGTCTCGTGGGATTCCCCAACGCTGGCAAA
AGCACCCTTCTTAAGGCCGTGTCCAATGCCAAACCAAAAATTGCAGCTTA
TCCCTTTACCACCATCCGACCCCAGATTGGAACCATCGAGTACAGGGACC
TGCGCTCCATCACAGTTGCCGATCTTCCCGGTCTGATCGAGGGCGCCCAC
GCGAACTTCGGCATGGGTCACAAGTTCCTGAAGCACATCGAACGCACCCG
CCTGCTGGTCTTCATGGTGGATATATTCGGCTTCCAGCTGAGTCCCAAAC
ATCCGCATCGCGACTGCTTGGCCAATGTGTATGCGCTCAACAAAGAGTTG
GAGCTCTACGATCCATCGCTGCTGGAGAAGCCCAGTGTCCTGCTGCTGAA
CAAAATGGACAAGGAGGGTGCCCACGAGATCTTTACCAAAGTTAAGCCGC
TCGTCAGCGATTTGGCCAGCGGACTTGAACAGTGCCCCGAGGAACTGCGT
CCGAAACAGGTGCTCAATTTCGACAGCATTGTCCCCATATCGGCCATGAA
CTCGTCGAAGATCACGCAAGTGAAATCCCAGCTAAGGAGGACCCTGGTGC
GGCTGGCTGAGAAGCAGTTCCTGGCGGACGAGGATCAGGTCAAGGAGAAG
CTAAGACAGCGCGTTGGGGTGGTGGGTCCAAAAATTACCTAGTTGTTATT
GCAAATAGTTTTGTGAGCGGCTTAAGAAATTAAATTAAATTTGTAGCAGC
GGAAAAAAAAAAAAAAA

FI02804.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG10628-RA 1407 CG10628-RA 108..1359 4..1255 6260 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19755770..19756416 1252..606 3235 100 Minus
chr2L 23010047 chr2L 19756475..19756997 605..83 2615 100 Minus
chr2L 23010047 chr2L 19757057..19757135 82..4 395 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG10628-RA 1152 CG10628-PA 1..1152 41..1192 5760 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:18 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG10628-RA 1254 CG10628-RA 6..1254 4..1252 6245 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG10628-PA 383 CG10628-PA 1..383 41..1189 1797 100 Plus
CG13390-PA 381 CG13390-PA 40..351 68..976 370 32.8 Plus
128up-PA 368 CG8340-PA 65..188 512..919 178 37.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19757242..19757891 1255..606 3250 100 Minus
2L 23513712 2L 19757950..19758472 605..83 2615 100 Minus
2L 23513712 2L 19758532..19758610 82..4 395 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19757242..19757891 1255..606 3250 100 Minus
2L 23513712 2L 19757950..19758472 605..83 2615 100 Minus
2L 23513712 2L 19758532..19758610 82..4 395 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:29:53 has no hits.

FI02804.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:31:01 Download gff for FI02804.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19757057..19757138 1..82 97   Minus
chr2L 19756475..19756997 83..605 100 <- Minus
chr2L 19755770..19756416 606..1252 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:40:18 Download gff for FI02804.complete
Subject Subject Range Query Range Percent Splice Strand
CG10628-RA 1..1152 41..1192 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:20:44 Download gff for FI02804.complete
Subject Subject Range Query Range Percent Splice Strand
CG10628-RA 1..1152 41..1192 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:02:06 Download gff for FI02804.complete
Subject Subject Range Query Range Percent Splice Strand
CG10628-RA 1..1152 41..1192 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:31:01 Download gff for FI02804.complete
Subject Subject Range Query Range Percent Splice Strand
CG10628-RA 1..1152 41..1192 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-04 10:00:20 Download gff for FI02804.complete
Subject Subject Range Query Range Percent Splice Strand
CG10628-RA 1..1252 2..1252 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:20:44 Download gff for FI02804.complete
Subject Subject Range Query Range Percent Splice Strand
CG10628-RA 1..1252 2..1252 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:02:06 Download gff for FI02804.complete
Subject Subject Range Query Range Percent Splice Strand
CG10628-RA 2..1254 1..1252 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:31:01 Download gff for FI02804.complete
Subject Subject Range Query Range Percent Splice Strand
CG10628-RA 2..1254 1..1252 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:31:01 Download gff for FI02804.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19758532..19758613 1..82 97   Minus
2L 19757950..19758472 83..605 100 <- Minus
2L 19757245..19757891 606..1252 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:02:06 Download gff for FI02804.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19758532..19758613 1..82 97   Minus
arm_2L 19757950..19758472 83..605 100 <- Minus
arm_2L 19757245..19757891 606..1252 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:52:15 Download gff for FI02804.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19758532..19758613 1..82 97   Minus
2L 19757950..19758472 83..605 100 <- Minus
2L 19757245..19757891 606..1252 100 <- Minus

FI02804.pep Sequence

Translation from 1 to 1191

> FI02804.pep
AVCSSLLYNAACAMVQIFKFLLKSSKSTGRAHFRPTFLDTLRLAVRGGHG
GNGLPKYGGVGGQGGCVYLVAKEGLTLRKVVQGLKDKRVAASSGEDSSKA
SIFGRRGADQRIEVPVGVQVYDDQQKLIADLDEHEATCIVAGGGTGGCTA
TNFLGRPGENRTVNLDLKLIADVGLVGFPNAGKSTLLKAVSNAKPKIAAY
PFTTIRPQIGTIEYRDLRSITVADLPGLIEGAHANFGMGHKFLKHIERTR
LLVFMVDIFGFQLSPKHPHRDCLANVYALNKELELYDPSLLEKPSVLLLN
KMDKEGAHEIFTKVKPLVSDLASGLEQCPEELRPKQVLNFDSIVPISAMN
SSKITQVKSQLRRTLVRLAEKQFLADEDQVKEKLRQRVGVVGPKIT*

FI02804.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15477-PA 383 GF15477-PA 1..383 14..396 1747 88.8 Plus
Dana\GF14685-PA 376 GF14685-PA 51..340 37..315 373 34 Plus
Dana\GF12286-PA 368 GF12286-PA 65..188 171..306 169 37.4 Plus
Dana\GF17362-PA 363 GF17362-PA 62..147 171..257 151 39.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21611-PA 383 GG21611-PA 1..383 14..396 1825 96.1 Plus
Dere\GG23451-PA 381 GG23451-PA 40..341 23..315 370 34.1 Plus
Dere\GG20239-PA 368 GG20239-PA 65..188 171..306 170 37.4 Plus
Dere\GG15886-PA 363 GG15886-PA 62..147 171..257 151 39.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13046-PA 383 GH13046-PA 1..383 14..396 1514 80.2 Plus
Dgri\GH10882-PA 375 GH10882-PA 44..370 37..372 389 33.4 Plus
Dgri\GH20854-PA 368 GH20854-PA 65..188 171..306 170 37.4 Plus
Dgri\GH23383-PA 363 GH23383-PA 62..147 171..257 151 39.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG10628-PA 383 CG10628-PA 1..383 14..396 1954 100 Plus
CG13390-PA 381 CG13390-PA 40..351 23..325 426 33.6 Plus
128up-PA 368 CG8340-PA 47..188 143..306 179 34.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18192-PA 384 GI18192-PA 1..384 14..396 1502 76.6 Plus
Dmoj\GI12998-PA 372 GI12998-PA 32..370 23..372 375 32.6 Plus
Dmoj\GI20960-PA 368 GI20960-PA 65..188 171..306 170 37.4 Plus
Dmoj\GI10336-PA 367 GI10336-PA 62..147 171..257 151 39.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25622-PA 383 GL25622-PA 1..383 14..396 1680 85.6 Plus
Dper\GL25811-PA 382 GL25811-PA 53..342 37..315 372 34 Plus
Dper\GL17092-PA 368 GL17092-PA 65..188 171..306 169 37.4 Plus
Dper\GL11955-PA 343 GL11955-PA 62..147 171..257 152 39.1 Plus
Dper\GL11553-PA 241 GL11553-PA 65..135 171..242 147 45.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10450-PA 383 GA10450-PA 1..383 14..396 1683 85.9 Plus
Dpse\GA12249-PA 382 GA12249-PA 53..342 37..315 372 34 Plus
Dpse\GA21003-PA 368 GA21003-PA 65..188 171..306 169 37.4 Plus
Dpse\GA19430-PA 363 GA19430-PA 62..147 171..257 151 39.1 Plus
Dpse\GA24766-PA 150 GA24766-PA 65..136 171..243 147 43.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16989-PA 383 GM16989-PA 1..383 14..396 1889 97.7 Plus
Dsec\GM12999-PA 381 GM12999-PA 52..341 37..315 371 33.8 Plus
Dsec\GM21327-PA 368 GM21327-PA 65..188 171..306 170 37.4 Plus
Dsec\GM26898-PA 363 GM26898-PA 62..147 171..257 151 39.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21736-PA 383 GD21736-PA 1..383 14..396 1983 98.2 Plus
Dsim\GD22413-PA 381 GD22413-PA 52..341 37..315 370 33.8 Plus
Dsim\GD20106-PA 363 GD20106-PA 62..147 171..257 151 39.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14682-PA 383 GJ14682-PA 1..383 14..396 1583 80.7 Plus
Dvir\GJ11528-PA 376 GJ11528-PA 44..365 37..367 375 32.8 Plus
Dvir\GJ20681-PA 368 GJ20681-PA 65..188 171..306 169 37.4 Plus
Dvir\GJ10190-PA 363 GJ10190-PA 62..147 171..257 151 39.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15220-PA 384 GK15220-PA 1..384 14..396 1588 78.1 Plus
Dwil\GK24168-PA 380 GK24168-PA 51..340 37..315 356 32.1 Plus
Dwil\GK21337-PA 368 GK21337-PA 65..188 171..306 170 37.4 Plus
Dwil\GK22817-PA 363 GK22817-PA 62..147 171..257 151 39.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12631-PA 383 GE12631-PA 1..383 14..396 1798 94.5 Plus
Dyak\GE11035-PA 384 GE11035-PA 52..341 37..315 373 34.1 Plus
Dyak\GE12398-PA 368 GE12398-PA 65..188 171..306 170 37.4 Plus
Dyak\GE25118-PA 363 GE25118-PA 62..147 171..257 151 39.1 Plus

FI02804.hyp Sequence

Translation from 2 to 1191

> FI02804.hyp
QVCSSLLYNAACAMVQIFKFLLKSSKSTGRAHFRPTFLDTLRLAVRGGHG
GNGLPKYGGVGGQGGCVYLVAKEGLTLRKVVQGLKDKRVAASSGEDSSKA
SIFGRRGADQRIEVPVGVQVYDDQQKLIADLDEHEATCIVAGGGTGGCTA
TNFLGRPGENRTVNLDLKLIADVGLVGFPNAGKSTLLKAVSNAKPKIAAY
PFTTIRPQIGTIEYRDLRSITVADLPGLIEGAHANFGMGHKFLKHIERTR
LLVFMVDIFGFQLSPKHPHRDCLANVYALNKELELYDPSLLEKPSVLLLN
KMDKEGAHEIFTKVKPLVSDLASGLEQCPEELRPKQVLNFDSIVPISAMN
SSKITQVKSQLRRTLVRLAEKQFLADEDQVKEKLRQRVGVVGPKIT*

FI02804.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG10628-PA 383 CG10628-PA 1..383 14..396 1954 100 Plus
CG13390-PA 381 CG13390-PA 40..351 23..325 426 33.6 Plus
128up-PA 368 CG8340-PA 47..188 143..306 179 34.5 Plus