Clone FI02811 Report

Search the DGRC for FI02811

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:11
Vector:pFlc-1
Associated Gene/TranscriptCG14960-RA
Protein status:FI02811.pep: gold
Sequenced Size:1458

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14960 2008-12-18 5.12 accounting

Clone Sequence Records

FI02811.complete Sequence

1458 bp assembled on 2008-12-09

GenBank Submission: BT053674.1

> FI02811.complete
AGTCAACGGGCACATCTCAAGCGTTGCAGTCGCTTTCCATGCGAACTTGA
TTCCAAACTATCTCCACTCCTTGGCCAATTCAGTTGAAGTCTCGTGTATA
TTTATTTTTTGGCCAACATCTGCGTGTCTACCATAGATTCGCGTGAAAGT
GGTCCAAATCAATCACTAAAAAACTCAGGATACAGCTGCAGCTAGTGTTG
CAATTATCATACACTAATCAAATAGTCACAGCCCTCATTATGTTTCTCAC
AAAGAGTTCAAGTGCGCGGCACTCGTTGCTGCTGCTTCTGTTGGCCTTTT
GCTGCCTGAGCAATGCCTTTGCAGCCAAGATAACGAAGAAGGTCGAAAAA
ACGTCGGAAAAGCCAGAGGTGGAGGCTGCTGCATCGCCAATCGAGGAGGA
AAATGACGATGAAGATGCTGGCGAGGATGGTGATGACGACGACGACGACG
AGGAGGAGGAGACGGGGGAACCTGCGGTGGATGCGGCTGACAAAGAAGCT
GCAGTAGGGGCATCGAGTAACAAGAACCCCAATGCAGTGCAGGCAGCCAC
GGATCCCACAGATCTCAGTGTCTGGGGCATGGTTCGCACTCTGTGGGGCT
GGCTTCGTAGCGATCTGAGTGAAAGCCTATTCGGCGATGACGACGACGGG
AAGCCCGCGTCCGGCAGCTCAGCTGTGGAGGGTCGTACCTTTGGCAAAAT
CCGCCGTCTTCAAATGGCTTTGATACCCATTATCTTTAAGTTTGGCGTCC
TTTCGGCTATGGTTGCCTTTCTGGTCGCCATTGGTATGAAGTCTCTGTTC
CTGCTCAAGGTCTTAGTGGTTATGAATGCCATTGCCATTCTGGGAAAGTT
CATTACCCTGAAGTCCAGTCTATTTGGACAGTATGAGAACACGGCGCCGT
CCTTCAATTACCCGGGCTGGAATCCTCATGCCAAGGAGTCGTGGGGCACC
ACTGGATTGAGTGGTCATGGCGCTGGTCATCCACCCAGCAAGGAGATTCA
CCTGCACATCCACGGAAATGCCCAGACCCAGGCTCAGCTCGCCGGTCAGG
GCTATCAGTATGAATCGCAGTCGGGTGGATGGGCCAGTCGATCGGATCCC
TATGGAGCCTATGCACCCACGGGCCAATTCACCGATAGCCAGCCCGTGGG
AGCAGTGGCCGGAGAGGTGCCCAACAATACGGATCCCATGTCCCTGCTGC
CCACGAAATATCGGGCGAGACAACTCATCCGCTGAGCAAGAGCTGTTCCA
CATGATGGGAGTTCCACATGGAAGTCAACGACCACCGCGTTTAATTAGCT
AGCACACATTTAGTCAGCGACTTTACGAGGACGCAGCTTTACTTACACCT
AAAACTATAGTTACGAGCCTAGTGTTTAATTAAATTATTTGCCCCAAGTA
GACTTAAAATCAATGATAATTTGTAATAAATAGTCGTAATGCAAAAAAAA
AAAAAAAA

FI02811.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG14960-RA 1490 CG14960-RA 41..1486 1..1446 7230 100 Plus
nc_10359.a 471 nc_10359.a 219..471 678..930 1265 100 Plus
nc_10359.a 471 nc_10359.a 1..219 24..242 1095 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3274896..3275660 678..1442 3825 100 Plus
chr3L 24539361 chr3L 3273449..3273885 242..678 2095 98.6 Plus
chr3L 24539361 chr3L 3270458..3270699 1..242 1180 99.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:47:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG14960-RA 996 CG14960-PA 1..996 240..1235 4980 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG14960-RA 1444 CG14960-RA 3..1444 1..1442 7210 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14960-PA 331 CG14960-PA 1..331 240..1232 1331 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3275491..3276259 678..1446 3845 100 Plus
3L 28110227 3L 3274044..3274480 242..678 2185 100 Plus
3L 28110227 3L 3271038..3271279 1..242 1210 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3275491..3276259 678..1446 3845 100 Plus
3L 28103327 3L 3274044..3274480 242..678 2185 100 Plus
3L 28103327 3L 3271038..3271279 1..242 1210 100 Plus
Blast to na_te.dros performed 2014-11-27 13:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1036..1135 1439..1340 130 61.4 Minus

FI02811.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:00:10 Download gff for FI02811.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3274897..3275660 679..1442 100   Plus
chr3L 3273672..3273885 465..678 99 -> Plus
chr3L 3273450..3273598 243..391 99 == Plus
chr3L 3270458..3270699 1..242 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:03:58 Download gff for FI02811.complete
Subject Subject Range Query Range Percent Splice Strand
CG14960-RA 1..996 240..1235 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:56 Download gff for FI02811.complete
Subject Subject Range Query Range Percent Splice Strand
CG14960-RA 1..996 240..1235 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:15:56 Download gff for FI02811.complete
Subject Subject Range Query Range Percent Splice Strand
CG14960-RA 1..996 240..1235 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:00:10 Download gff for FI02811.complete
Subject Subject Range Query Range Percent Splice Strand
CG14960-RA 1..996 240..1235 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-09 18:57:40 Download gff for FI02811.complete
Subject Subject Range Query Range Percent Splice Strand
CG14960-RA 1..1442 1..1442 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:55 Download gff for FI02811.complete
Subject Subject Range Query Range Percent Splice Strand
CG14960-RA 1..1442 1..1442 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:15:56 Download gff for FI02811.complete
Subject Subject Range Query Range Percent Splice Strand
CG14960-RA 3..1444 1..1442 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:00:10 Download gff for FI02811.complete
Subject Subject Range Query Range Percent Splice Strand
CG14960-RA 3..1444 1..1442 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:00:10 Download gff for FI02811.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3275492..3276255 679..1442 100   Plus
3L 3274045..3274480 243..678 100 -> Plus
3L 3271038..3271279 1..242 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:15:56 Download gff for FI02811.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3275492..3276255 679..1442 100   Plus
arm_3L 3274045..3274480 243..678 100 -> Plus
arm_3L 3271038..3271279 1..242 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:36 Download gff for FI02811.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3275492..3276255 679..1442 100   Plus
3L 3274045..3274480 243..678 100 -> Plus
3L 3271038..3271279 1..242 100 -> Plus

FI02811.pep Sequence

Translation from 239 to 1234

> FI02811.pep
MFLTKSSSARHSLLLLLLAFCCLSNAFAAKITKKVEKTSEKPEVEAAASP
IEEENDDEDAGEDGDDDDDDEEEETGEPAVDAADKEAAVGASSNKNPNAV
QAATDPTDLSVWGMVRTLWGWLRSDLSESLFGDDDDGKPASGSSAVEGRT
FGKIRRLQMALIPIIFKFGVLSAMVAFLVAIGMKSLFLLKVLVVMNAIAI
LGKFITLKSSLFGQYENTAPSFNYPGWNPHAKESWGTTGLSGHGAGHPPS
KEIHLHIHGNAQTQAQLAGQGYQYESQSGGWASRSDPYGAYAPTGQFTDS
QPVGAVAGEVPNNTDPMSLLPTKYRARQLIR*

FI02811.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 17:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10127-PA 343 GF10127-PA 6..343 2..331 1252 79.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 17:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15119-PA 333 GG15119-PA 1..333 1..331 1379 91.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 17:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15779-PA 352 GH15779-PA 131..351 100..330 925 78.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 17:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14960-PA 331 CG14960-PA 1..331 1..331 1719 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 17:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12558-PA 341 GI12558-PA 2..341 1..331 917 64.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 17:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21236-PA 305 GL21236-PA 117..305 145..331 798 84.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 17:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13385-PA 340 GA13385-PA 1..340 1..331 1073 76.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 17:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14554-PA 329 GM14554-PA 1..329 1..331 1396 95.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 17:51:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13746-PA 329 GD13746-PA 1..329 1..331 1413 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 17:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15461-PA 336 GJ15461-PA 2..336 1..331 1095 66.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 17:51:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10604-PA 387 GK10604-PA 41..387 2..331 1069 71 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 17:52:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21346-PA 333 GE21346-PA 1..333 1..331 1337 93.1 Plus

FI02811.hyp Sequence

Translation from 239 to 1234

> FI02811.hyp
MFLTKSSSARHSLLLLLLAFCCLSNAFAAKITKKVEKTSEKPEVEAAASP
IEEENDDEDAGEDGDDDDDDEEEETGEPAVDAADKEAAVGASSNKNPNAV
QAATDPTDLSVWGMVRTLWGWLRSDLSESLFGDDDDGKPASGSSAVEGRT
FGKIRRLQMALIPIIFKFGVLSAMVAFLVAIGMKSLFLLKVLVVMNAIAI
LGKFITLKSSLFGQYENTAPSFNYPGWNPHAKESWGTTGLSGHGAGHPPS
KEIHLHIHGNAQTQAQLAGQGYQYESQSGGWASRSDPYGAYAPTGQFTDS
QPVGAVAGEVPNNTDPMSLLPTKYRARQLIR*

FI02811.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:21:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14960-PA 331 CG14960-PA 1..331 1..331 1719 100 Plus