Clone FI02831 Report

Search the DGRC for FI02831

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:31
Vector:pFlc-1
Associated Gene/TranscriptCG33281-RA
Protein status:FI02831.pep: gold
Sequenced Size:1603

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33281 2008-12-18 5.12 accounting

Clone Sequence Records

FI02831.complete Sequence

1603 bp assembled on 2008-11-04

GenBank Submission: BT050438.1

> FI02831.complete
GCTTAGTTAAACGCGAACACCTACGGATATTTGACGGCCGGGTCCGGTTG
AAAATCAGCCTAAACGGAGGACTTGTCGTGCTATGAACTACCGATAATAG
GATTTAATTTAAATATTCCGCAAAATGAGTTCCACCGGCGGTGACAAATA
CCAATATCTAGCTGCAATCAGTGTAAACATCATTTCGATTTCGTATGGCG
CTTTTTGCGGATGGCCATCGTCCAGTTTCCTGGAATTGTCATCAGAAAAT
AGTCCTTTGGATACGGGTCCTTTGACGCCAACGGATCAGGGATGGGTGGC
GTCGAATATATGCCTGGGAGGCCTGGTGGGCACCTTTCTGTTTACCTGGC
TGGCGGACAGAATCGGCAGGAAATTGTGTCTCATGTGGATGGCGCTGCCC
AATTTGCTAGGCTGGGTGATAATACCGTTCGCGCGCACTCCCATGCATTT
AATTATCGCTAGATTTATTGGTGGAGCCGCTGGCGGTGGATGTTTCACAG
TGATTCCCATTTATATAGCCGAGTTAGCCTCGGACAATATTCGCGGCATT
TTGGGCGTCTTTTTGGTGCTGACCTGCAATTTCGGTCTCGTGCTGGCCTT
CGTCCTTGGCTACTACTTCAACTATGCCCAAGTGTCCTGGATTGTGTCCT
CGCTGTCCTTTGTGTTCGTCGGCTGTTTCTGGTTCATGCCGGAAACACCG
CAGCACCTGGCCAAGATAAACAAGATTGAGGAGGCGGAGCATTCGCTGCG
CTACTACCGGAACATCAAGTCTAATCCGGCCAAGGAACTCAGCGAGGAGC
TGCAACTGGAGCTTCAGAAGTTAAAGACCACCGAGAAGACCACTGCGGAT
GGAGTTGATGACGATGACGCGGCCACCGGCGTAACTTGGTCCGACTTCGC
TGAGGGCAAGACTCGAAAGGCATTCCTAATCGGACTCGGACTGATAAGCT
TCAATCAGCTGTGCGGATGCTTCGCCATGCTGAACTATACGGCCGTAATT
TTCGAGCAAGCTGGCTCCAGCCTTCCGCCCACAGTGGCCGCCATCATAGT
GGGTGTCATCCAACTAATGGGCACCTATGCATCCACCGTTTTGGTGGAGC
GACTGGGCCGTAAGATCCTGCTCCTGGTCTCTGCGGTGGGAATCGGATTG
GGCCAGAGTGCGATGGGCACGTATAGCTACTTCCAGATGCTCGGATGCCC
AGTGGCATCGTTCAGCTGGGTGCCCATCGCTGGGTTCTCCTTCATGCTGT
TCCTGGCTGCAGTCGGACTGCTCTCCCTGCCATTCCTGGTGGTATCGGAA
ATAATGCCGCAGAAGATAAGGAGCACGGCCATCATGATTCTAATGTCGAC
ACTCTGGTTAATTTCCACCTGCGCCGTAAAGTTGATGCCGGTTTTCACTG
AATCCCTAGGAATGCACGGAACCGTCTTCATGTTTGCCAGCTTATCCTTC
CTAGCAGCAATTTTCATCGCTATTTTCGTGCCCGAAACCAAGGGCAAGTC
AGTTGATGCCATCTTGGCCAGTCTCTAGTACCTATGACTTATATTTAAAC
CAATTGTTATTGCTGTTAATAAATCCGCTAAGAAGCGCAAAAAAAAAAAA
AAA

FI02831.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG33281-RA 1691 CG33281-RA 57..1645 1..1589 7945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:13:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3325503..3325985 899..1381 2415 100 Plus
chr2L 23010047 chr2L 3324743..3325109 538..904 1790 99.2 Plus
chr2L 23010047 chr2L 3324270..3324503 173..406 1170 100 Plus
chr2L 23010047 chr2L 3326051..3326259 1380..1588 1045 100 Plus
chr2L 23010047 chr2L 3323865..3324037 1..173 865 100 Plus
chr2L 23010047 chr2L 3324558..3324689 406..537 630 98.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG33281-RA 1404 CG33281-PA 1..1404 125..1528 7020 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG33281-RA 1594 CG33281-RA 7..1594 1..1588 7940 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG33281-PA 467 CG33281-PA 1..461 125..1507 2033 100 Plus
CG14606-PB 438 CG14606-PB 29..434 269..1498 608 33.9 Plus
CG14606-PA 438 CG14606-PA 29..434 269..1498 608 33.9 Plus
CG15406-PA 469 CG15406-PA 2..467 104..1504 593 33.5 Plus
CG15408-PA 466 CG15408-PA 17..463 143..1504 555 30.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:13:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3325881..3326363 899..1381 2415 100 Plus
2L 23513712 2L 3325121..3325487 538..904 1820 99.7 Plus
2L 23513712 2L 3324648..3324881 173..406 1170 100 Plus
2L 23513712 2L 3326429..3326638 1380..1589 1050 100 Plus
2L 23513712 2L 3324243..3324415 1..173 865 100 Plus
2L 23513712 2L 3324936..3325067 406..537 660 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3325881..3326363 899..1381 2415 100 Plus
2L 23513712 2L 3325121..3325487 538..904 1820 99.7 Plus
2L 23513712 2L 3324648..3324881 173..406 1170 100 Plus
2L 23513712 2L 3326429..3326638 1380..1589 1050 100 Plus
2L 23513712 2L 3324243..3324415 1..173 865 100 Plus
2L 23513712 2L 3324936..3325067 406..537 660 100 Plus
Blast to na_te.dros performed on 2014-11-26 20:13:04 has no hits.

FI02831.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:23:50 Download gff for FI02831.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3326053..3326259 1382..1588 100   Plus
chr2L 3325504..3325985 900..1381 100 -> Plus
chr2L 3324743..3325104 538..899 99 -> Plus
chr2L 3324559..3324689 407..537 98 -> Plus
chr2L 3324271..3324503 174..406 100 -> Plus
chr2L 3323865..3324037 1..173 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:40:55 Download gff for FI02831.complete
Subject Subject Range Query Range Percent Splice Strand
CG33281-RA 1..1404 125..1528 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:17:58 Download gff for FI02831.complete
Subject Subject Range Query Range Percent Splice Strand
CG33281-RA 1..1404 125..1528 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:59:29 Download gff for FI02831.complete
Subject Subject Range Query Range Percent Splice Strand
CG33281-RA 1..1404 125..1528 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:23:50 Download gff for FI02831.complete
Subject Subject Range Query Range Percent Splice Strand
CG33281-RA 1..1404 125..1528 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:58:09 Download gff for FI02831.complete
Subject Subject Range Query Range Percent Splice Strand
CG33281-RA 1..1584 1..1584 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:17:58 Download gff for FI02831.complete
Subject Subject Range Query Range Percent Splice Strand
CG33281-RA 10..1597 1..1588 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:59:29 Download gff for FI02831.complete
Subject Subject Range Query Range Percent Splice Strand
CG33281-RA 7..1594 1..1588 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 11:07:57 Download gff for FI02831.complete
Subject Subject Range Query Range Percent Splice Strand
CG33281-RA 1..1584 1..1584 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:23:50 Download gff for FI02831.complete
Subject Subject Range Query Range Percent Splice Strand
CG33281-RA 7..1594 1..1588 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:23:50 Download gff for FI02831.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3326431..3326637 1382..1588 100   Plus
2L 3325882..3326363 900..1381 100 -> Plus
2L 3325121..3325482 538..899 100 -> Plus
2L 3324937..3325067 407..537 100 -> Plus
2L 3324649..3324881 174..406 100 -> Plus
2L 3324243..3324415 1..173 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:59:29 Download gff for FI02831.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3326431..3326637 1382..1588 100   Plus
arm_2L 3325882..3326363 900..1381 100 -> Plus
arm_2L 3325121..3325482 538..899 100 -> Plus
arm_2L 3324937..3325067 407..537 100 -> Plus
arm_2L 3324649..3324881 174..406 100 -> Plus
arm_2L 3324243..3324415 1..173 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:49:08 Download gff for FI02831.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3326431..3326637 1382..1588 100   Plus
2L 3325882..3326363 900..1381 100 -> Plus
2L 3325121..3325482 538..899 100 -> Plus
2L 3324937..3325067 407..537 100 -> Plus
2L 3324649..3324881 174..406 100 -> Plus
2L 3324243..3324415 1..173 100 -> Plus

FI02831.pep Sequence

Translation from 124 to 1527

> FI02831.pep
MSSTGGDKYQYLAAISVNIISISYGAFCGWPSSSFLELSSENSPLDTGPL
TPTDQGWVASNICLGGLVGTFLFTWLADRIGRKLCLMWMALPNLLGWVII
PFARTPMHLIIARFIGGAAGGGCFTVIPIYIAELASDNIRGILGVFLVLT
CNFGLVLAFVLGYYFNYAQVSWIVSSLSFVFVGCFWFMPETPQHLAKINK
IEEAEHSLRYYRNIKSNPAKELSEELQLELQKLKTTEKTTADGVDDDDAA
TGVTWSDFAEGKTRKAFLIGLGLISFNQLCGCFAMLNYTAVIFEQAGSSL
PPTVAAIIVGVIQLMGTYASTVLVERLGRKILLLVSAVGIGLGQSAMGTY
SYFQMLGCPVASFSWVPIAGFSFMLFLAAVGLLSLPFLVVSEIMPQKIRS
TAIMILMSTLWLISTCAVKLMPVFTESLGMHGTVFMFASLSFLAAIFIAI
FVPETKGKSVDAILASL*

FI02831.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14177-PA 469 GF14177-PA 1..469 1..467 1881 77 Plus
Dana\GF14176-PA 465 GF14176-PA 1..465 1..467 1736 70.9 Plus
Dana\GF14173-PA 469 GF14173-PA 16..467 8..460 682 34.6 Plus
Dana\GF17316-PA 443 GF17316-PA 1..439 15..458 631 33.6 Plus
Dana\GF14180-PA 466 GF14180-PA 17..463 7..460 616 31.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24931-PA 467 GG24931-PA 1..467 1..467 2166 92.7 Plus
Dere\GG25315-PA 438 GG25315-PA 1..434 20..458 696 35.1 Plus
Dere\GG24927-PA 469 GG24927-PA 16..467 8..460 685 34.1 Plus
Dere\GG24934-PA 466 GG24934-PA 17..463 7..460 637 31.8 Plus
Dere\GG24933-PA 466 GG24933-PA 22..463 7..460 615 30 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11266-PA 465 GH11266-PA 1..465 1..467 1486 64.7 Plus
Dgri\GH11263-PA 469 GH11263-PA 16..467 8..460 705 35 Plus
Dgri\GH19286-PA 457 GH19286-PA 18..455 8..460 676 33.6 Plus
Dgri\GH11269-PA 465 GH11269-PA 17..462 7..460 638 32.5 Plus
Dgri\GH14820-PA 465 GH14820-PA 17..462 7..460 628 32.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG33281-PA 467 CG33281-PA 1..467 1..467 2395 100 Plus
CG14606-PB 438 CG14606-PB 1..434 20..458 710 34.7 Plus
CG14606-PA 438 CG14606-PA 1..434 20..458 710 34.7 Plus
CG15406-PA 469 CG15406-PA 18..467 10..460 689 33.9 Plus
CG15408-PA 466 CG15408-PA 17..463 7..460 659 31.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16729-PA 463 GI16729-PA 1..463 1..467 1634 67.2 Plus
Dmoj\GI16693-PA 465 GI16693-PA 12..463 8..460 710 34.3 Plus
Dmoj\GI23497-PA 466 GI23497-PA 18..464 8..460 683 33.5 Plus
Dmoj\GI16696-PA 469 GI16696-PA 16..467 8..460 657 34.6 Plus
Dmoj\GI16683-PA 469 GI16683-PA 16..468 8..461 654 33.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18604-PA 467 GL18604-PA 1..467 1..467 1880 76.4 Plus
Dper\GL12191-PA 443 GL12191-PA 1..441 15..460 659 35 Plus
Dper\GL18609-PA 466 GL18609-PA 17..463 7..460 653 32 Plus
Dper\GL18607-PA 457 GL18607-PA 15..454 8..460 647 33.3 Plus
Dper\GL18608-PA 466 GL18608-PA 19..463 4..460 617 30.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25714-PA 467 GA25714-PA 1..467 1..467 1880 76.4 Plus
Dpse\GA13105-PB 438 GA13105-PB 1..436 20..460 646 34.9 Plus
Dpse\GA13708-PA 466 GA13708-PA 17..463 7..460 646 31.8 Plus
Dpse\GA25715-PA 842 GA25715-PA 400..839 8..460 637 33.1 Plus
Dpse\GA17181-PA 466 GA17181-PA 19..463 4..460 617 30.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18407-PA 468 GM18407-PA 1..468 1..467 2195 95.7 Plus
Dsec\GM10497-PA 438 GM10497-PA 1..434 20..458 649 34.2 Plus
Dsec\GM18411-PA 466 GM18411-PA 17..463 7..460 638 31.4 Plus
Dsec\GM10496-PA 452 GM10496-PA 9..450 8..460 615 31.5 Plus
Dsec\GM24627-PA 539 GM24627-PA 74..525 2..467 562 30.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:56:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23220-PA 467 GD23220-PA 1..467 1..467 2191 97.9 Plus
Dsim\GD23217-PA 469 GD23217-PA 16..467 8..460 681 34.4 Plus
Dsim\GD19494-PA 438 GD19494-PA 1..434 20..458 680 34.5 Plus
Dsim\GD23223-PA 466 GD23223-PA 17..463 7..460 642 31.4 Plus
Dsim\GD23221-PA 460 GD23221-PA 15..457 8..460 626 32.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17184-PA 465 GJ17184-PA 1..465 1..467 1613 67 Plus
Dvir\GJ17181-PA 469 GJ17181-PA 16..467 8..460 679 35.4 Plus
Dvir\GJ17189-PA 466 GJ17189-PA 17..463 7..460 671 33.3 Plus
Dvir\GJ17188-PA 462 GJ17188-PA 17..459 7..460 651 33.8 Plus
Dvir\GJ10247-PA 466 GJ10247-PA 18..464 8..460 641 32.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18458-PA 471 GK18458-PA 7..471 5..467 1815 71.8 Plus
Dwil\GK18461-PA 465 GK18461-PA 22..465 7..462 669 33.6 Plus
Dwil\GK18463-PA 461 GK18463-PA 17..458 7..460 654 33 Plus
Dwil\GK18459-PA 458 GK18459-PA 13..455 8..460 639 32 Plus
Dwil\GK12884-PA 463 GK12884-PA 17..460 7..460 628 31.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18223-PA 467 GE18223-PA 1..467 1..467 2066 91.4 Plus
Dyak\GE18219-PA 469 GE18219-PA 16..467 8..460 679 34.1 Plus
Dyak\GE25805-PA 438 GE25805-PA 1..434 20..458 659 34.5 Plus
Dyak\GE18226-PA 466 GE18226-PA 17..463 7..460 634 31.6 Plus
Dyak\GE18224-PA 460 GE18224-PA 15..457 8..460 617 32.5 Plus

FI02831.hyp Sequence

Translation from 124 to 1527

> FI02831.hyp
MSSTGGDKYQYLAAISVNIISISYGAFCGWPSSSFLELSSENSPLDTGPL
TPTDQGWVASNICLGGLVGTFLFTWLADRIGRKLCLMWMALPNLLGWVII
PFARTPMHLIIARFIGGAAGGGCFTVIPIYIAELASDNIRGILGVFLVLT
CNFGLVLAFVLGYYFNYAQVSWIVSSLSFVFVGCFWFMPETPQHLAKINK
IEEAEHSLRYYRNIKSNPAKELSEELQLELQKLKTTEKTTADGVDDDDAA
TGVTWSDFAEGKTRKAFLIGLGLISFNQLCGCFAMLNYTAVIFEQAGSSL
PPTVAAIIVGVIQLMGTYASTVLVERLGRKILLLVSAVGIGLGQSAMGTY
SYFQMLGCPVASFSWVPIAGFSFMLFLAAVGLLSLPFLVVSEIMPQKIRS
TAIMILMSTLWLISTCAVKLMPVFTESLGMHGTVFMFASLSFLAAIFIAI
FVPETKGKSVDAILASL*

FI02831.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG33281-PA 467 CG33281-PA 1..467 1..467 2395 100 Plus
CG14606-PB 438 CG14606-PB 1..434 20..458 710 34.7 Plus
CG14606-PA 438 CG14606-PA 1..434 20..458 710 34.7 Plus
CG15406-PA 469 CG15406-PA 18..467 10..460 689 33.9 Plus
CG15408-PA 466 CG15408-PA 17..463 7..460 659 31.2 Plus