Clone FI02832 Report

Search the DGRC for FI02832

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:32
Vector:pFlc-1
Associated Gene/TranscriptRad17-RA
Protein status:FI02832.pep: gold
Sequenced Size:1816

Clone Sequence Records

FI02832.complete Sequence

1816 bp assembled on 2008-12-22

GenBank Submission: BT056240.1

> FI02832.complete
ATGTGGTAACACTGCTAAAGAAGAAGAGGAGTTAATTCTAAAAATGAGCG
TACGGAAGAAAACTTGGGTAAGATGTGCCTTCAGCGAGATGAACTTGACC
ACCAGTCCTGCTCCTTCGGAATCCACGCCTGCGAAGCGCACAAGAAGTGC
AAGCAATGTGAGCAGCTCCAGAGTATCGAGGTCGAGAACTCCAAGCATAA
ATACAAAGCCAATACAGATTCCGGACGTGGACTCAGTCGATCTTACTGCC
ATGGATGATGACCAGGATGCGGACATCACTGTGCCACCGCCAGAAGTCAA
AGAAAACTGGATGGAAAGCTTTGAGCCAGCCACCAGCGACGATTTGGCGG
TGCATCCAAAGAAGGTCGGAGAACTACGCGATTGGCTGCGTCACTGCGAA
GCGGTGCGCAAGAAGTTCCCGGCTCAAATGTGTCTACTTACCGGGCCCAC
TGGTGCTGGCAAAACCACCACGTTGCGAGTCCTGGCCAAGGAGTTCGGCT
ACCAGCTGCAGGAGTGGATCAATCCTATCGATTGTGAGGTGGTCAACACC
TTGGGTGATCAAACGACTGGCGCCTCCTATGTGGGCTCCCATCTGGAGGC
CTTTAAAAGCTTTCTGCTCCGTGCCTCGCGATACAAATCCTTGCTGGACT
CGCAAAATAAGAGACTGCTTCTTGTCGAGGACTTTCCCAACGTCCTGCTC
AGCGATAAGGAGGTCAACTTTGAAGAGTTACTAGAAGAGTACACGGCGTA
TGGCAAATCTCCCCTGGTGTTCATCGTTGCCGATGCCAAATCTCGAGGAT
TGAATATCAGCTACCGCCTCTTTCCAGACCAACTGAAGGCCAAACATCGC
ATCGAGCACATCAGTTTCAATGCTATTGCATCTACAATCATGCAAAAGTC
AATGAAAACCTTCTGCTCCGTAATGCAGCAGAATAAAGCTACTTACAAGG
TGCCCTCGACCGCTGTTGTTGACTCAATAGTTGTCGGTGCCCAGGGCGAC
ATAAGAAATGCGTTAATTAATTTACATTTGAGCTCTTTAAAGGGAGTTTC
CAGCATGCCGACCAAACAGCTAAATGTCAGTGTGTCCGCAAAAGGTCGTA
AGAAGAAAATGCAAAGTACTTTAAAGTCAATTGGTAGAGATGAATCAATT
ACTCTGATGCACGCACTTGGAAGAGTATTAAATCCTAAGTTTAATGAGGA
CAAAACTATGTTACACAGCCCGGAGGAAATAACCGAAGCCTTTAATACAG
AGCCCAGGAATTTTGTGAATTTTGTATATGCCAACTATCTGCCGCATTTT
AAGGAAATCGATGATGTCGTGACCGCCATAAATGACTTGGGCCTATCAGA
TTGCATGCTCAACGAGTACAGAGATGATAATTTGTCTGTGATGGGCTTAA
ACGTTGCCATACGAGGAGTTATGATGTCCAATACGTGCCCTGTCAGCGGA
TGGATGCCTGTTCGAGGACCCAAGCGAATCAATATACAGCCACAGGCAAC
TTTGGCCGAACAAAGACTAGTGGGTGTGGGCTACGCGGGCATTGCCAGGA
CGCTCTACGCCACGGAGTACAGCTCATTAGTTAAGTTAATAGCAGGCAAG
CCTGTGGATACTACTTCAAGCCAAAGCACAGACTCAAAACAAGACTTTTA
GTAAATCAAAACTATTTATCTGATGTTAAAACTAAAGTAGCAAGGAAGTT
TTTAAAAAATGTCCCTAGGACCAAATATGATATCTAACAATCGCAAAACC
CAGTTTATTATATAAATTAAATGTACTGCGCATCCCACCGTAAGAAAACG
AAAAAAAAAAAAAAAA

FI02832.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
Rad17-RA 1904 Rad17-RA 15..1813 4..1802 8965 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:22:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10487155..10487833 735..57 3395 100 Minus
chr3R 27901430 chr3R 10485948..10486555 1798..1191 3025 99.8 Minus
chr3R 27901430 chr3R 10486610..10487068 1194..736 2280 99.8 Minus
chr3R 27901430 chr3R 10487887..10487941 58..4 275 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
Rad17-RA 1608 CG7825-PA 1..1608 44..1651 8025 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:37 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Rad17-RA 1823 CG7825-RA 9..1803 4..1798 8960 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:22:32
Subject Length Description Subject Range Query Range Score Percent Strand
Rad17-PA 535 CG7825-PA 1..521 44..1606 2481 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14662403..14663081 735..57 3395 100 Minus
3R 32079331 3R 14661192..14661803 1802..1191 3030 99.7 Minus
3R 32079331 3R 14661858..14662316 1194..736 2280 99.8 Minus
3R 32079331 3R 14663135..14663189 58..4 275 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14403234..14403912 735..57 3395 100 Minus
3R 31820162 3R 14402023..14402634 1802..1191 3030 99.6 Minus
3R 31820162 3R 14402689..14403147 1194..736 2280 99.7 Minus
3R 31820162 3R 14403966..14404020 58..4 275 100 Minus
Blast to na_te.dros performed 2014-11-27 09:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6254..6327 1638..1711 127 63.5 Plus
mdg3 5519 mdg3 DMMDG3 5519bp Derived from X95908 (e990667) (Rel. 49, Last updated, Version 3). 2129..2240 1632..1741 124 63.2 Plus

FI02832.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:20:33 Download gff for FI02832.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10487887..10487944 1..58 98   Minus
chr3R 10487155..10487831 59..735 100 <- Minus
chr3R 10486614..10487068 736..1190 100 <- Minus
chr3R 10485946..10486555 1191..1800 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:20 Download gff for FI02832.complete
Subject Subject Range Query Range Percent Splice Strand
Rad17-RA 1..1608 44..1651 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:26:46 Download gff for FI02832.complete
Subject Subject Range Query Range Percent Splice Strand
Rad17-RA 1..1608 44..1651 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:11:44 Download gff for FI02832.complete
Subject Subject Range Query Range Percent Splice Strand
Rad17-RA 1..1608 44..1651 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:20:33 Download gff for FI02832.complete
Subject Subject Range Query Range Percent Splice Strand
Rad17-RA 1..1608 44..1651 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-22 12:02:27 Download gff for FI02832.complete
Subject Subject Range Query Range Percent Splice Strand
Rad17-RA 1..1800 1..1800 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:26:46 Download gff for FI02832.complete
Subject Subject Range Query Range Percent Splice Strand
Rad17-RA 1..1800 1..1800 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:11:44 Download gff for FI02832.complete
Subject Subject Range Query Range Percent Splice Strand
Rad17-RA 1..1800 1..1800 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:20:33 Download gff for FI02832.complete
Subject Subject Range Query Range Percent Splice Strand
Rad17-RA 6..1805 1..1800 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:20:33 Download gff for FI02832.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14663135..14663192 1..58 98   Minus
3R 14662403..14663079 59..735 100 <- Minus
3R 14661862..14662316 736..1190 100 <- Minus
3R 14661194..14661803 1191..1800 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:11:44 Download gff for FI02832.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10488857..10488914 1..58 98   Minus
arm_3R 10488125..10488801 59..735 100 <- Minus
arm_3R 10487584..10488038 736..1190 100 <- Minus
arm_3R 10486916..10487525 1191..1800 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:59:17 Download gff for FI02832.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14403966..14404023 1..58 98   Minus
3R 14403234..14403910 59..735 100 <- Minus
3R 14402693..14403147 736..1190 100 <- Minus
3R 14402025..14402634 1191..1800 99 <- Minus

FI02832.pep Sequence

Translation from 1 to 1650

> FI02832.pep
CGNTAKEEEELILKMSVRKKTWVRCAFSEMNLTTSPAPSESTPAKRTRSA
SNVSSSRVSRSRTPSINTKPIQIPDVDSVDLTAMDDDQDADITVPPPEVK
ENWMESFEPATSDDLAVHPKKVGELRDWLRHCEAVRKKFPAQMCLLTGPT
GAGKTTTLRVLAKEFGYQLQEWINPIDCEVVNTLGDQTTGASYVGSHLEA
FKSFLLRASRYKSLLDSQNKRLLLVEDFPNVLLSDKEVNFEELLEEYTAY
GKSPLVFIVADAKSRGLNISYRLFPDQLKAKHRIEHISFNAIASTIMQKS
MKTFCSVMQQNKATYKVPSTAVVDSIVVGAQGDIRNALINLHLSSLKGVS
SMPTKQLNVSVSAKGRKKKMQSTLKSIGRDESITLMHALGRVLNPKFNED
KTMLHSPEEITEAFNTEPRNFVNFVYANYLPHFKEIDDVVTAINDLGLSD
CMLNEYRDDNLSVMGLNVAIRGVMMSNTCPVSGWMPVRGPKRINIQPQAT
LAEQRLVGVGYAGIARTLYATEYSSLVKLIAGKPVDTTSSQSTDSKQDF*

FI02832.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17539-PA 520 GF17539-PA 1..518 15..543 2015 70 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21143-PA 536 GG21143-PA 1..536 15..549 2648 91.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18931-PA 518 GH18931-PA 1..516 15..533 1750 63.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
Rad17-PA 535 CG7825-PA 1..535 15..549 2738 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22078-PA 493 GI22078-PA 2..491 34..533 1734 63.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13446-PA 531 GL13446-PA 1..516 15..533 2070 73.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26853-PB 535 GA26853-PB 1..520 30..533 1966 70.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25836-PA 535 GM25836-PA 1..535 15..549 2803 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20407-PA 535 GD20407-PA 1..535 15..549 2796 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22898-PA 512 GJ22898-PA 1..507 15..530 1823 66.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:48:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14447-PA 533 GK14447-PA 1..525 15..533 1942 68.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:48:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26434-PA 537 GE26434-PA 1..537 15..549 2634 91.1 Plus

FI02832.hyp Sequence

Translation from 1 to 1650

> FI02832.hyp
YGNTAKEEEELILKMSVRKKTWVRCAFSEMNLTTSPAPSESTPAKRTRSA
SNVSSSRVSRSRTPSINTKPIQIPDVDSVDLTAMDDDQDADITVPPPEVK
ENWMESFEPATSDDLAVHPKKVGELRDWLRHCEAVRKKFPAQMCLLTGPT
GAGKTTTLRVLAKEFGYQLQEWINPIDCEVVNTLGDQTTGASYVGSHLEA
FKSFLLRASRYKSLLDSQNKRLLLVEDFPNVLLSDKEVNFEELLEEYTAY
GKSPLVFIVADAKSRGLNISYRLFPDQLKAKHRIEHISFNAIASTIMQKS
MKTFCSVMQQNKATYKVPSTAVVDSIVVGAQGDIRNALINLHLSSLKGVS
SMPTKQLNVSVSAKGRKKKMQSTLKSIGRDESITLMHALGRVLNPKFNED
KTMLHSPEEITEAFNTEPRNFVNFVYANYLPHFKEIDDVVTAINDLGLSD
CMLNEYRDDNLSVMGLNVAIRGVMMSNTCPVSGWMPVRGPKRINIQPQAT
LAEQRLVGVGYAGIARTLYATEYSSLVKLIAGKPVDTTSSQSTDSKQDF*

FI02832.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Rad17-PA 535 CG7825-PA 1..535 15..549 2738 100 Plus