Clone FI02833 Report

Search the DGRC for FI02833

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:33
Vector:pFlc-1
Associated Gene/TranscriptCG6738-RA
Protein status:FI02833.pep: gold
Sequenced Size:1302

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6738 2008-12-18 5.12 accounting

Clone Sequence Records

FI02833.complete Sequence

1302 bp assembled on 2008-10-27

GenBank Submission: BT050439.1

> FI02833.complete
ATTTCTACTTTACCATCCTAACGATTCATATTAAAAATGAGTGCCGAAAA
ATGGGAAAAGAACGAGGAAATTCGAATATTCCGGGAGTATTTGCGAATTC
CATCTGTACACCCTAATATTGATTATACTGCTTGTGTGGAGTTTATTAAG
CGGCAGGCAGATTCCCTCAATCTGCCCGTGGAAGTAGTTTTTCCAGCTGT
TAAATCAAAACCTGTGGTGATCATTAAATGGGAAGGAAGCCAGCCAAAGT
TGCCCTCAATCATTTTAAGCTCGCACATGGACGTGGTTCCTGTATTCCCG
GAAATGTGGACCCATGAACCCTTCTCCGCCGACATCGACGAGGAGGGTAG
GATCTTTGCACGAGGTGCTCAGGACATGAAATCGGTGGGCACTCAGTATC
TAGGAGCTATACGCCTGCTGAGGGCTGATGGCTTTCAGCCGAAAAGGACG
CTCTATGTAACCTTTGTTCCTGACGAGGAGATTGGAGGCATCCATGGCAT
GGCAGCGTTCGTTGAAACTGACTTTTACAAACAAATGAATGTGGGATTCA
GCTTGGACGAGGGTGGAACTAGTGCTTCTGATGTTCATCACTTGTTCTAC
GCCGAGCGTATACGATGGATTCTCAAATTGAAAGTTGCTGGAACCGCCGG
TCATGGTTCTCTATTGTTGCCCGATACAGCCGGAGTTAAGTTGAACTATG
TGTTGAACAAGCTGACGGAGTTCCGTGAATCGCAAATCCAGCGACTGAAA
AACGACAAAAGCCTGAGCATCGGGGATGTGACCACGGTGAATCTCACCCA
GTTGAGTGGCGGAGTGCAGAGCAATGTGGTTCCACCGCTTTTTGAGGCCA
TTTTCGACATACGTCTAGCCATAACCCTGGATTTGGTTGCATTTGAGCGG
GAAATTCGAAATTGGTGCGAGGAGGCAGGTGGAGGCATTGACATCGAGTT
CCCACTGAAAGAGGCCTATGTGGCGGCCACCAGGCTGGATGATTCAAACC
CCTATTGGTTAGCTTTGAAAGTCGCTCTGGATGAACTGGGTCTTAAAGTT
AAGCCGATAGTGTGTTTTGCAGTCACCGATTGTCGTTTTATTCGCCAGCA
GGGAACCCCAGCAATTGGTTTCTCACCCATCATAAACACTACAGTACTAA
TCCATGACCATGATGAATTTTTAAGGGCTGATGATTATTTGAATGGCATA
CAAGTTTACAAGAAGATTATTCCTAATCTCACTGAAGTCTAGCCAATGTC
TTCTCTCTGTCCAATAAAACTTTGTTGAAATACTGGAAAAAAAAAAAAAA
AA

FI02833.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG6738-RA 1379 CG6738-RA 3..1290 1..1288 6440 100 Plus
CG6733-RA 1639 CG6733-RA 432..887 270..725 840 78.9 Plus
CG6733-RA 1639 CG6733-RA 922..1113 760..951 450 82.2 Plus
CG17109-RA 1464 CG17109-RA 344..512 251..419 365 81 Plus
CG6733-RA 1639 CG6733-RA 1139..1403 977..1241 350 75.4 Plus
CG6733-RA 1639 CG6733-RA 197..401 35..239 320 77 Plus
CG17109-RA 1464 CG17109-RA 861..990 768..897 305 82.3 Plus
CG17109-RA 1464 CG17109-RA 694..827 601..734 205 76.8 Plus
CG17109-RA 1464 CG17109-RA 130..239 34..143 160 76.3 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:26:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18923142..18923630 128..616 2385 99.2 Plus
chr3R 27901430 chr3R 18923687..18924105 620..1038 2035 99 Plus
chr3R 27901430 chr3R 18924158..18924406 1038..1286 1230 99.6 Plus
chr3R 27901430 chr3R 18921334..18921824 128..618 835 78 Plus
chr3R 27901430 chr3R 18922961..18923087 1..127 620 99.2 Plus
chr3R 27901430 chr3R 18921887..18922303 622..1038 510 74.8 Plus
chr3R 27901430 chr3R 18919878..18920184 639..945 455 76.5 Plus
chr3R 27901430 chr3R 18919390..18919753 211..574 425 74.5 Plus
chr3R 27901430 chr3R 18922404..18922563 1082..1241 290 78.8 Plus
chr3R 27901430 chr3R 18916183..18916349 775..941 235 76 Plus
chr3R 27901430 chr3R 6502260..6502397 403..266 195 76.1 Minus
chr3R 27901430 chr3R 18917399..18917518 270..389 195 77.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG6738-RA 1206 CG6738-PA 1..1206 37..1242 6030 100 Plus
CG6733-RA 1206 CG6733-PA 10..1205 46..1241 1690 76.1 Plus
CG17109-RB 1203 CG17109-PB 1..906 37..945 835 73 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:38 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG6738-RA 1291 CG6738-RA 6..1291 1..1286 6430 100 Plus
CG6733-RA 1291 CG6733-RA 30..1236 35..1241 1700 76.1 Plus
CG17109-RB 1373 CG17109-RB 41..949 34..945 850 73.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG6738-PA 401 CG6738-PA 1..401 37..1239 2080 100 Plus
CG6733-PA 401 CG6733-PA 1..401 37..1239 1700 79.3 Plus
CG17109-PB 400 CG17109-PB 1..400 37..1239 1565 72.8 Plus
CG17109-PA 400 CG17109-PA 1..400 37..1239 1565 72.8 Plus
CG6726-PC 401 CG6726-PC 1..400 37..1236 1480 66.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23099719..23100210 128..619 2460 100 Plus
3R 32079331 3R 23100264..23100682 620..1038 2095 100 Plus
3R 32079331 3R 23100735..23100985 1038..1288 1255 100 Plus
3R 32079331 3R 23097907..23098397 128..618 820 77.8 Plus
3R 32079331 3R 23099538..23099664 1..127 635 100 Plus
3R 32079331 3R 23098460..23098876 622..1038 525 75.1 Plus
3R 32079331 3R 23096451..23096757 639..945 455 76.5 Plus
3R 32079331 3R 23095963..23096326 211..574 425 74.5 Plus
3R 32079331 3R 23098977..23099136 1082..1241 305 79.4 Plus
3R 32079331 3R 23092756..23092922 775..941 235 76 Plus
3R 32079331 3R 23092179..23092417 251..489 205 72.4 Plus
3R 32079331 3R 23093972..23094091 270..389 195 77.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:29:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22840550..22841041 128..619 2460 100 Plus
3R 31820162 3R 22841095..22841513 620..1038 2095 100 Plus
3R 31820162 3R 22841566..22841816 1038..1288 1255 100 Plus
3R 31820162 3R 22838880..22839228 270..618 710 80.2 Plus
3R 31820162 3R 22840369..22840495 1..127 635 100 Plus
3R 31820162 3R 22839429..22839620 760..951 450 82.2 Plus
3R 31820162 3R 22836834..22837002 251..419 365 81 Plus
3R 31820162 3R 22837411..22837540 768..897 305 82.3 Plus
3R 31820162 3R 22839808..22839967 1082..1241 305 79.3 Plus
3R 31820162 3R 22833587..22833645 775..833 205 89.8 Plus
3R 31820162 3R 22834803..22834922 270..389 195 77.5 Plus
3R 31820162 3R 22838738..22838849 128..239 185 77.6 Plus
3R 31820162 3R 22837282..22837377 639..734 180 79.1 Plus
3R 31820162 3R 22839291..22839394 622..725 160 76.9 Plus
3R 31820162 3R 22836561..22836622 34..95 145 82.2 Plus
Blast to na_te.dros performed on 2014-11-27 15:26:28 has no hits.

FI02833.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:29:53 Download gff for FI02833.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18924158..18924406 1038..1286 99   Plus
chr3R 18923687..18924104 620..1037 99 -> Plus
chr3R 18923142..18923633 128..619 98 -> Plus
chr3R 18922961..18923087 1..127 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:40:59 Download gff for FI02833.complete
Subject Subject Range Query Range Percent Splice Strand
CG6738-RA 1..1206 37..1242 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:17:07 Download gff for FI02833.complete
Subject Subject Range Query Range Percent Splice Strand
CG6738-RA 1..1206 37..1242 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:00:58 Download gff for FI02833.complete
Subject Subject Range Query Range Percent Splice Strand
CG6738-RA 1..1206 37..1242 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:29:53 Download gff for FI02833.complete
Subject Subject Range Query Range Percent Splice Strand
CG6738-RA 1..1206 37..1242 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:56:55 Download gff for FI02833.complete
Subject Subject Range Query Range Percent Splice Strand
CG6738-RA 1..1286 1..1286 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:17:07 Download gff for FI02833.complete
Subject Subject Range Query Range Percent Splice Strand
CG6738-RA 3..1288 1..1286 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:00:58 Download gff for FI02833.complete
Subject Subject Range Query Range Percent Splice Strand
CG6738-RA 6..1291 1..1286 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-27 10:00:10 Download gff for FI02833.complete
Subject Subject Range Query Range Percent Splice Strand
CG6738-RA 1..1286 1..1286 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:29:53 Download gff for FI02833.complete
Subject Subject Range Query Range Percent Splice Strand
CG6738-RA 6..1291 1..1286 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:29:53 Download gff for FI02833.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23100735..23100983 1038..1286 100   Plus
3R 23100264..23100681 620..1037 100 -> Plus
3R 23099719..23100210 128..619 100 -> Plus
3R 23099538..23099664 1..127 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:00:58 Download gff for FI02833.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18926457..18926705 1038..1286 100   Plus
arm_3R 18925986..18926403 620..1037 100 -> Plus
arm_3R 18925441..18925932 128..619 100 -> Plus
arm_3R 18925260..18925386 1..127 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:48:10 Download gff for FI02833.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22841566..22841814 1038..1286 100   Plus
3R 22841095..22841512 620..1037 100 -> Plus
3R 22840550..22841041 128..619 100 -> Plus
3R 22840369..22840495 1..127 100 -> Plus

FI02833.pep Sequence

Translation from 36 to 1241

> FI02833.pep
MSAEKWEKNEEIRIFREYLRIPSVHPNIDYTACVEFIKRQADSLNLPVEV
VFPAVKSKPVVIIKWEGSQPKLPSIILSSHMDVVPVFPEMWTHEPFSADI
DEEGRIFARGAQDMKSVGTQYLGAIRLLRADGFQPKRTLYVTFVPDEEIG
GIHGMAAFVETDFYKQMNVGFSLDEGGTSASDVHHLFYAERIRWILKLKV
AGTAGHGSLLLPDTAGVKLNYVLNKLTEFRESQIQRLKNDKSLSIGDVTT
VNLTQLSGGVQSNVVPPLFEAIFDIRLAITLDLVAFEREIRNWCEEAGGG
IDIEFPLKEAYVAATRLDDSNPYWLALKVALDELGLKVKPIVCFAVTDCR
FIRQQGTPAIGFSPIINTTVLIHDHDEFLRADDYLNGIQVYKKIIPNLTE
V*

FI02833.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16978-PA 397 GF16978-PA 3..397 6..401 1661 76.8 Plus
Dana\GF16977-PA 400 GF16977-PA 1..400 1..401 1632 74.3 Plus
Dana\GF16979-PA 398 GF16979-PA 2..398 4..401 1611 75.1 Plus
Dana\GF16975-PA 401 GF16975-PA 1..400 1..400 1485 65 Plus
Dana\GF16976-PA 401 GF16976-PA 1..400 1..400 1397 62 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:47:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11187-PA 398 GG11187-PA 1..398 1..401 1706 78.8 Plus
Dere\GG11186-PA 400 GG11186-PA 1..400 1..401 1603 72.8 Plus
Dere\GG11184-PA 401 GG11184-PA 1..400 1..400 1505 66.8 Plus
Dere\GG11185-PA 402 GG11185-PA 6..401 4..400 1368 62.5 Plus
Dere\GG17281-PA 401 GG17281-PA 1..401 1..401 1265 56.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23739-PA 401 GH23739-PA 1..401 1..401 1491 65.1 Plus
Dgri\GH23814-PA 400 GH23814-PA 1..400 1..401 1453 64.6 Plus
Dgri\GH23872-PA 401 GH23872-PA 1..401 1..401 1441 63.3 Plus
Dgri\GH11206-PA 402 GH11206-PA 1..401 1..401 1262 56.6 Plus
Dgri\GH11748-PA 402 GH11748-PA 1..401 1..401 1251 56.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:47:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG6738-PA 401 CG6738-PA 1..401 1..401 2080 100 Plus
CG6733-PA 401 CG6733-PA 1..401 1..401 1700 79.3 Plus
CG17109-PB 400 CG17109-PB 1..400 1..401 1565 72.8 Plus
CG17109-PA 400 CG17109-PA 1..400 1..401 1565 72.8 Plus
CG6726-PC 401 CG6726-PC 1..400 1..400 1480 66.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23017-PA 401 GI23017-PA 1..401 1..401 1495 66.3 Plus
Dmoj\GI23019-PA 401 GI23019-PA 1..401 1..401 1405 62.6 Plus
Dmoj\GI23020-PA 401 GI23020-PA 1..401 1..401 1401 62.1 Plus
Dmoj\GI23018-PA 399 GI23018-PA 1..393 1..395 1396 64.1 Plus
Dmoj\GI18128-PA 402 GI18128-PA 1..401 1..401 1275 56.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13664-PA 401 GL13664-PA 1..399 1..399 1634 73.9 Plus
Dper\GL13662-PA 401 GL13662-PA 1..400 1..400 1520 67 Plus
Dper\GL13663-PA 401 GL13663-PA 1..401 1..401 1476 67.1 Plus
Dper\GL23825-PA 406 GL23825-PA 1..401 1..401 1270 57.1 Plus
Dper\GL23826-PA 401 GL23826-PA 1..401 1..401 1230 55.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19818-PA 401 GA19818-PA 1..399 1..399 1637 74.2 Plus
Dpse\GA19815-PA 401 GA19815-PA 1..400 1..400 1521 67.2 Plus
Dpse\GA26984-PA 401 GA26984-PA 1..401 1..401 1482 67.1 Plus
Dpse\GA27068-PA 406 GA27068-PA 1..401 1..401 1269 56.9 Plus
Dpse\GA29129-PA 406 GA29129-PA 1..401 1..401 1261 56.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26487-PA 401 GM26487-PA 1..401 1..401 1758 80 Plus
Dsec\GM26486-PA 400 GM26486-PA 1..400 1..401 1600 72.8 Plus
Dsec\GM26483-PA 401 GM26483-PA 1..400 1..400 1506 66.2 Plus
Dsec\GM26485-PA 402 GM26485-PA 6..401 4..400 1329 62.7 Plus
Dsec\GM26165-PA 401 GM26165-PA 1..401 1..401 1295 57.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:47:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21001-PA 401 GD21001-PA 1..401 1..401 2070 96.5 Plus
Dsim\GD21000-PA 401 GD21000-PA 1..401 1..401 1762 80 Plus
Dsim\GD20999-PA 400 GD20999-PA 1..400 1..401 1596 72.6 Plus
Dsim\GD20996-PA 401 GD20996-PA 1..400 1..400 1516 66.8 Plus
Dsim\GD20998-PA 402 GD20998-PA 6..401 4..400 1341 63.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24611-PA 401 GJ24611-PA 1..401 1..401 1488 65.6 Plus
Dvir\GJ24612-PA 399 GJ24612-PA 1..399 1..401 1449 65.8 Plus
Dvir\GJ24614-PA 401 GJ24614-PA 1..401 1..401 1433 62.6 Plus
Dvir\GJ17753-PA 402 GJ17753-PA 1..401 1..401 1204 56.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14410-PA 401 GK14410-PA 1..400 1..400 1485 65.2 Plus
Dwil\GK14413-PA 401 GK14413-PA 1..401 1..401 1463 65.3 Plus
Dwil\GK14412-PA 400 GK14412-PA 1..399 1..400 1379 62.7 Plus
Dwil\GK22579-PA 401 GK22579-PA 1..401 1..401 1275 58.1 Plus
Dwil\GK22580-PA 403 GK22580-PA 1..403 1..401 1215 53.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10355-PA 401 GE10355-PA 1..401 1..401 2040 94.3 Plus
Dyak\GE10354-PA 401 GE10354-PA 1..401 1..401 1754 79.8 Plus
Dyak\GE10353-PA 400 GE10353-PA 1..400 1..401 1601 72.8 Plus
Dyak\GE10351-PA 401 GE10351-PA 1..400 1..400 1502 66.5 Plus
Dyak\GE10352-PA 402 GE10352-PA 6..401 4..400 1340 63.2 Plus

FI02833.hyp Sequence

Translation from 36 to 1241

> FI02833.hyp
MSAEKWEKNEEIRIFREYLRIPSVHPNIDYTACVEFIKRQADSLNLPVEV
VFPAVKSKPVVIIKWEGSQPKLPSIILSSHMDVVPVFPEMWTHEPFSADI
DEEGRIFARGAQDMKSVGTQYLGAIRLLRADGFQPKRTLYVTFVPDEEIG
GIHGMAAFVETDFYKQMNVGFSLDEGGTSASDVHHLFYAERIRWILKLKV
AGTAGHGSLLLPDTAGVKLNYVLNKLTEFRESQIQRLKNDKSLSIGDVTT
VNLTQLSGGVQSNVVPPLFEAIFDIRLAITLDLVAFEREIRNWCEEAGGG
IDIEFPLKEAYVAATRLDDSNPYWLALKVALDELGLKVKPIVCFAVTDCR
FIRQQGTPAIGFSPIINTTVLIHDHDEFLRADDYLNGIQVYKKIIPNLTE
V*

FI02833.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG6738-PA 401 CG6738-PA 1..401 1..401 2080 100 Plus
CG6733-PA 401 CG6733-PA 1..401 1..401 1700 79.3 Plus
CG17109-PB 400 CG17109-PB 1..400 1..401 1565 72.8 Plus
CG17109-PA 400 CG17109-PA 1..400 1..401 1565 72.8 Plus
CG6726-PC 401 CG6726-PC 1..400 1..400 1480 66.5 Plus