Clone FI02838 Report

Search the DGRC for FI02838

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:38
Vector:pFlc-1
Associated Gene/TranscriptCG8027-RA
Protein status:FI02838.pep: gold
Sequenced Size:2610

Clone Sequence Records

FI02838.complete Sequence

2610 bp assembled on 2008-12-22

GenBank Submission: BT056242.1

> FI02838.complete
AGTTCTAGCACGGCCACACTGTCCCGCAGGAAAACAATGTTTGTTATGAT
TTTACTGCGGGAATTGTGTGTGAAATGTGCCATTTGAGGACCTGAGAATG
CGATTACGCCGCCGTTGGCCGCGAAGGATGCGGCGTGCCATGGAACAACT
GCGTCTCCAGTCCCGCCGGAAGCTGCTGGCGCTCACGATGACTGGAGGAC
TCTGCCTGGCTATCTGGGTAGTTGCCAACTATCTGTCCGCATCGGAGGAG
GGCCAAACCGGCGGCTTCAGCAGCGCCTGCACTGCCATCGATGCGGTTTA
CACGTGGGTCAATGGCTCGGATCCCAACTTTATTGAGGACATCCGGCGAT
TCGATGACAAGTACGATCCCTCGCGGTTCGATGACAAGAATGAGCTGCGG
TACTCTCTGAGGTCCCTGGAAAAACACGCCGCATGGATCAGGCATGTGTA
CATAGTAACCAATGGCCAGATTCCAAGTTGGCTGGATCTCAGCTACGAAA
GGGTCACGGTGGTGCCCCACGAAGTCCTGGCTCCCGATCCCGACCAGCTG
CCCACCTTCTCCAGCTCGGCCATCGAGACATTTCTGCACCGCATACCAAA
GCTGTCCAAGAGGTTCCTCTACCTCAACGACGACATATTCCTGGGAGCTC
CGCTGTATCCGGAGGACTTGTACACTGAAGCGGAGGGAGTTCGCGTGTAC
CAGGCATGGATGGTGCCCGGCTGCGCCTTGGATTGCCCCTGGACGTACAT
AGGTGATGGAGCTTGCGATCGGCACTGCAACATTGATGCGTGCCAATTTG
ATGGAGGCGACTGCAGTGAAACTGGGCCAGCGAGCGATGCCCACGTCATT
CCACCAAGCAAAGAAGTGCTCGAGGTGCAGCCTGCCGCTGTTCCACAATC
AAGAGTCCACCGATTTCCTCAGATGGGTCTCCAAAAGCTGTTCAGGCGCA
GCTCTGCCAATTTTAAGGATGTTATGCGGCACCGCAATGTGTCCACACTC
AAGGAACTACGTCGCATTGTGGAGCGTTTTAACAAGGCCAAACTCATGTC
GCTGAACCCCGAACTGGAGACCTCCAGCTCCGAGCCACAGACAACTCAGC
GCCACGGGCTGCGCAAGGAGGATTTTAAGTCTTCCACCGATATTTACTCT
CACTCGCTGATTGCCACCAATATGTTGCTGAATAGAGCCTATGGCTTTAA
GGCACGCCATGTCCTGGCGCACGTGGGCTTCCTAATTGACAAGGATATTG
TGGAGGCCATGCAGCGACGTTTTCACCAGCAAATTCTGGACACTGCCCAT
CAGCGCTTCCGAGCCCCAACAGATTTGCAGTACGCATTCGCTTACTACTC
CTTCCTAATGAGCGAAACCAAAGTAATGAGTGTAGAGGAAATCTTCGATG
AGTTCGACACGGACGGTTCGGCCACCTGGTCGGATCGAGAGGTGCGAACC
TTTCTCACTCGCATCTATCAGCCGCCACTTGACTGGTCTGCCATGCGCTA
CTTCGAGGAGGTGGTTCAAAACTGCACAAGAAATCTGGGCATGCATTTAA
AAGTGGACACAGTCGAACACTCCACGCTGGTCTACGAGCGATACGAGGAC
TCTAATTTGCCTACAATAACCAGGGATTTGGTTGTCCGATGTCCACTTCT
GGCCGAAGCTTTGGCGGCAAACTTTGCAGTCCGACCCAAATATAACTTCC
ATGTCAGCCCAAAAAGAACTTCGCACAGCAATTTTATGATGCTCACATCG
AATCTCACGGAGGTGGTGGAGTCACTGGACCGATTGCGTCGGAATCCGCG
CAAGTTTAACTGCATCAACGACAATCTGGATGCCAATAGAGGCGAAGACA
ACGAGATGGTGCGCCATCTGCTCGAGGACTTTTACCTCTCCTTCTTTCCG
AGACGCAGCAAGTTCGAGCTGCCGCCGCAATATCGTAATCGGTTCGAGTC
CTGGCGGGACTTTCAGCGCTGGAAGAGAAGAAAGCGGGCGGTTCTCGTGA
TTGGATATGGAGTGAGTCTGCTGCTTGTGGTCTGTCTGCTGCGATTCATG
TGCCACCACAAGGCGAAGCTGGTGAGGCGCTGTGTGCAGCGCTTGTAGGA
TCGATTTCGTGAAGTTCTCTCCCTTCTGCAATGTTGTGATATGTTGTGAA
CATTTATGTAAATTGGCCATTTCTGCAAGCGATCATAGTCAAATCTAGTT
GTAGGCCATGTGTAAGGCTATTTTTCTAGTTCTTTAGGTGCATGCTAGAG
GCTACGTTTAGAAATAGTCATTAAGGATGGATGCGTAGTGAAATTTTTTA
GAATATTTTGTGGTCCAGCTTTTGCAGTCGACCTGTTTTGTGTTCAGTTT
CATAATATCTAAGTTTCTATATTACTATTTCTAAGTTTGGCTTTACAATG
ATATTTGCTCACCTTAAAAGTACTGAACTGAAATATTCTAAATACCTAGT
TTAATTTTGTTTACAAAATACGTAACTCGAACATACACAATGTACACATA
TTGATATAATGGAGTACGCCTTAAATGATATTTATACATTTTGCTAGTGA
ATGTTCTTCATTCTAAACAAAATAAACCATTTCTATTGATTTCCAAAAAA
AAAAAAAAAA

FI02838.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG8027-RA 2748 CG8027-RA 129..2724 1..2596 12965 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5093023..5094443 1609..189 7105 100 Minus
chr2R 21145070 chr2R 5091981..5092966 2594..1609 4915 99.9 Minus
chr2R 21145070 chr2R 5094505..5094692 188..1 940 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG8027-RA 2001 CG8027-PA 1..2001 98..2098 10005 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:40 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG8027-RA 2597 CG8027-RA 4..2597 1..2594 12955 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG8027-PA 666 CG8027-PA 14..666 137..2095 3455 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9205452..9206872 1609..189 7105 100 Minus
2R 25286936 2R 9204408..9205395 2596..1609 4925 99.9 Minus
2R 25286936 2R 9206934..9207121 188..1 940 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9206651..9208071 1609..189 7105 100 Minus
2R 25260384 2R 9205607..9206594 2596..1609 4925 99.8 Minus
2R 25260384 2R 9208133..9208320 188..1 940 100 Minus
Blast to na_te.dros performed on 2014-11-27 04:09:34 has no hits.

FI02838.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:25:56 Download gff for FI02838.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5094505..5094692 1..188 100   Minus
chr2R 5093023..5094443 189..1609 100 <- Minus
chr2R 5091981..5092965 1610..2594 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:22 Download gff for FI02838.complete
Subject Subject Range Query Range Percent Splice Strand
CG8027-RA 1..2001 98..2098 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:26:50 Download gff for FI02838.complete
Subject Subject Range Query Range Percent Splice Strand
CG8027-RA 1..2001 98..2098 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:22 Download gff for FI02838.complete
Subject Subject Range Query Range Percent Splice Strand
CG8027-RA 1..2001 98..2098 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:25:56 Download gff for FI02838.complete
Subject Subject Range Query Range Percent Splice Strand
CG8027-RA 1..2001 98..2098 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-22 12:02:32 Download gff for FI02838.complete
Subject Subject Range Query Range Percent Splice Strand
CG8027-RA 1..2594 1..2594 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:26:50 Download gff for FI02838.complete
Subject Subject Range Query Range Percent Splice Strand
CG8027-RA 1..2594 1..2594 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:22 Download gff for FI02838.complete
Subject Subject Range Query Range Percent Splice Strand
CG8027-RA 4..2597 1..2594 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:25:56 Download gff for FI02838.complete
Subject Subject Range Query Range Percent Splice Strand
CG8027-RA 4..2597 1..2594 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:25:56 Download gff for FI02838.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9206934..9207121 1..188 100   Minus
2R 9205452..9206872 189..1609 100 <- Minus
2R 9204410..9205394 1610..2594 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:22 Download gff for FI02838.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5094439..5094626 1..188 100   Minus
arm_2R 5092957..5094377 189..1609 100 <- Minus
arm_2R 5091915..5092899 1610..2594 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:59:21 Download gff for FI02838.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9208133..9208320 1..188 100   Minus
2R 9206651..9208071 189..1609 100 <- Minus
2R 9205609..9206593 1610..2594 99 <- Minus

FI02838.pep Sequence

Translation from 97 to 2097

> FI02838.pep
MRLRRRWPRRMRRAMEQLRLQSRRKLLALTMTGGLCLAIWVVANYLSASE
EGQTGGFSSACTAIDAVYTWVNGSDPNFIEDIRRFDDKYDPSRFDDKNEL
RYSLRSLEKHAAWIRHVYIVTNGQIPSWLDLSYERVTVVPHEVLAPDPDQ
LPTFSSSAIETFLHRIPKLSKRFLYLNDDIFLGAPLYPEDLYTEAEGVRV
YQAWMVPGCALDCPWTYIGDGACDRHCNIDACQFDGGDCSETGPASDAHV
IPPSKEVLEVQPAAVPQSRVHRFPQMGLQKLFRRSSANFKDVMRHRNVST
LKELRRIVERFNKAKLMSLNPELETSSSEPQTTQRHGLRKEDFKSSTDIY
SHSLIATNMLLNRAYGFKARHVLAHVGFLIDKDIVEAMQRRFHQQILDTA
HQRFRAPTDLQYAFAYYSFLMSETKVMSVEEIFDEFDTDGSATWSDREVR
TFLTRIYQPPLDWSAMRYFEEVVQNCTRNLGMHLKVDTVEHSTLVYERYE
DSNLPTITRDLVVRCPLLAEALAANFAVRPKYNFHVSPKRTSHSNFMMLT
SNLTEVVESLDRLRRNPRKFNCINDNLDANRGEDNEMVRHLLEDFYLSFF
PRRSKFELPPQYRNRFESWRDFQRWKRRKRAVLVIGYGVSLLLVVCLLRF
MCHHKAKLVRRCVQRL*

FI02838.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13092-PA 662 GF13092-PA 1..662 1..666 2987 84.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10571-PA 666 GG10571-PA 16..666 16..666 3230 94 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20030-PA 674 GH20030-PA 20..674 17..666 2659 76.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG8027-PA 666 CG8027-PA 1..666 1..666 3527 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19208-PA 668 GI19208-PA 20..668 17..666 2592 76.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17627-PA 653 GL17627-PA 1..653 11..666 2792 79.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20775-PB 664 GA20775-PB 1..664 1..666 2814 78.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20617-PA 666 GM20617-PA 16..666 16..666 3448 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10091-PA 666 GD10091-PA 16..666 16..666 3464 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20278-PA 672 GJ20278-PA 20..672 17..666 2651 76.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17971-PA 647 GK17971-PA 15..647 14..666 2545 72.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22445-PA 666 GE22445-PA 16..666 16..666 3249 94.2 Plus

FI02838.hyp Sequence

Translation from 97 to 2097

> FI02838.hyp
MRLRRRWPRRMRRAMEQLRLQSRRKLLALTMTGGLCLAIWVVANYLSASE
EGQTGGFSSACTAIDAVYTWVNGSDPNFIEDIRRFDDKYDPSRFDDKNEL
RYSLRSLEKHAAWIRHVYIVTNGQIPSWLDLSYERVTVVPHEVLAPDPDQ
LPTFSSSAIETFLHRIPKLSKRFLYLNDDIFLGAPLYPEDLYTEAEGVRV
YQAWMVPGCALDCPWTYIGDGACDRHCNIDACQFDGGDCSETGPASDAHV
IPPSKEVLEVQPAAVPQSRVHRFPQMGLQKLFRRSSANFKDVMRHRNVST
LKELRRIVERFNKAKLMSLNPELETSSSEPQTTQRHGLRKEDFKSSTDIY
SHSLIATNMLLNRAYGFKARHVLAHVGFLIDKDIVEAMQRRFHQQILDTA
HQRFRAPTDLQYAFAYYSFLMSETKVMSVEEIFDEFDTDGSATWSDREVR
TFLTRIYQPPLDWSAMRYFEEVVQNCTRNLGMHLKVDTVEHSTLVYERYE
DSNLPTITRDLVVRCPLLAEALAANFAVRPKYNFHVSPKRTSHSNFMMLT
SNLTEVVESLDRLRRNPRKFNCINDNLDANRGEDNEMVRHLLEDFYLSFF
PRRSKFELPPQYRNRFESWRDFQRWKRRKRAVLVIGYGVSLLLVVCLLRF
MCHHKAKLVRRCVQRL*

FI02838.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG8027-PA 666 CG8027-PA 1..666 1..666 3527 100 Plus