Clone FI02841 Report

Search the DGRC for FI02841

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:41
Vector:pFlc-1
Associated Gene/TranscriptCG13160-RA
Protein status:FI02841.pep: gold
Sequenced Size:2747

Clone Sequence Records

FI02841.complete Sequence

2747 bp assembled on 2009-08-12

GenBank Submission: BT099562.1

> FI02841.complete
AGTCTTGCTTCGGGAGTCGTGAAAGGTGCTCTTGCTTGGACGGTTCTCGA
ATCTCTTCAAAAAAAAATGGGAGCCACTAGGAATGGCAAGTCCCTTTCGG
GGTCTGAGAACCTAATAATCGAGGTGGATGAGGACAAGATCCGTTGCAAG
CAGTATTCCTGGTACTTTGCCCCCATCTACCTCCTGTTCTGGGTGGGTCT
CTTCTTCGCCGTCATATATCCACTTTTCCAGGCCTTGCCCACCGGAATCA
AAATCTCCGAGGAGGCGGATAAACCGGGACAATTCGTGGCCGAGAGAGCT
CAGGAAATACTGCTGCAAATAAGTCGATTGGGACCCCGTGTGGTGGGTGA
TGTTGATAATGAAGTCACAGTTGTGAATTTGCTGCTCGCTGAAATCGAAA
AAGTGCGCCAGGTGCTGCGAGACGATGTCTATGAAATGGAGGTGGAGGTG
CAACGGGCATCCGGATCCTACTTGATCAAAGGCCTAACGAATCACTATCA
GGGTGTGCAGAATGTGATCGTTAGACTGAGTACGAAGAGCTCAAATAGCA
CCTCCTACCTTTTGGTCAATAGTCACTACGATACCAAGCCGGGTTCACCT
GGTGCCGGAGATGATGCTGCCATGGTTGTCGTAATGCTGGAGGTACTGCG
TCTGGTCGCCGTTTCAGGGGATCCCTTCCTGCATCCGATTATATTCCTTT
TCAATGGTGCCGAAGAGCAGCCAATGCAGGGATCACATGGTTTCATCACG
CAGCACAGATGGGCTGCCAACTGCAAGGCTCTACTGAACTTGGATTCCGC
TGGCGCTGGTGGACGTGATTTGCTCTTCCAGGGCGGTCCCAATCATCCCT
GGCTGATGGAGCATTACAGAAACAGTGCCCCGCACCCGTTCGCCACCACA
ACGGCCGAGGAGATGTTCGAGGCTGGTATCATACCATCGGATACTGATTT
CCGGATCTTTCGGGACTTTGGAGTTGTGCCAGGCTTGGACATGGCCGGCG
TGTACAATGGATTCGTTTATCACACGAAATTCGATCGCTACGCGGTGATA
AGTCTCGATTCCCTGCAGAATTCCGGCGACAATTTACTGGCCTTGGTATG
GAGTATTTCGAATGCCGAAGAAATGTACGACACAGAGGCACACGCGGCGG
GACATGCAGTATTCTTCGACTTTATTGGACTGTTCTTTGTCCATTACCAG
GAGTCGACTAGCTTGGCCCTGAATCTCTTCTTCTCGTTCGGTGCCATTTT
GCTGGTCTGCATCTCGTTGTGGCGAATGTCCCGGGTTACTGGACAGACTA
TGGGCACCTATGCCGGCGTCTTTGGACTCCTATTCCTGCTAGCCCTAGCT
GGTGCTCTCCTCGCCGTGGCCTTTCCTCTGCTGATGGCCACCTTTTATGA
TTGGGGAAATAGAACGTTGACCTATTTTAGCAACAGTTGGCTGGTCATTG
GGTTGTACATTTGTCCATCGGTTATTGGCCTTGTACTGCCCATGACCCTC
TACTTGACGCATACGAAGTGTAACAAGATCCCCCATACTTATTACTTGCA
TATTGTGGGTCACGCGAACTGTGTCCTTTTGGCCATCTTGTGTTTGGGTG
CAACGGCTCTTAAATACCGTAGTGCCTATCTATTTCTGATCTCTCTCATT
TTCTACGTTGCTGCTCTGATCATTAACCTACTGACCCGTCTCCATTGTCG
CGGTTATCTGTGGTCACTGGTGCTGATTGTTTTCCAGATTATACCCTTCA
TTTACCACGCCTACTTGTTCCACATGTTCATACTTATTCTCATTCCGATG
ACTGGTCGCTTTGGCGTCTCCACCAATCCGGATATACTAATCGGCGCTCT
ATGTGGTTTTGGCACAATTTTGGCGTTATCTTTTGCTGCTCCTTTAATCA
ATGTCTTTCGGCGACCGAACTGCATGCTGGGTGGTCTGGCACTGGTTATG
TTTATTTTCTGCATGATTGCCGTCTCGGATGTCGGATTCCCGTATCGGCC
CAAAACAAATGTCATGCGTGCCGACTTCATGCAAGTGCATCGCAAATTTT
TCGAGTACAATGGTTCCATCAGCCACGAGGATTCTGGCTACTACTTCCAT
CTGGGGGATCGAAACAAAGAGGCACCTCTGCGCGATCACATGAACCTGAC
CAACCTGGTACGCCTGGGCGAGGATTGCGACTCCGAGCTGATGTGCGGTA
TTCCCTGCTACCGATATTGTAGTGCCCGGGAGCATGCACTTTGGCTTGCT
CGAGAGGAGCCCGTGGAACTGCCTTATCCAACGGTCTTGGAGTTCCTTAG
CAAGACAGTTCTGTCCGGTGGCTATCAGGTGCGCTATGAGTTCCGGCTAA
CTGGTCCGCCAAATATGGGTCTGTTCTTCAAGCCACTGGATGGTGTAAAA
CTACTCCGATGGACGTTTGCTCCCGCAATGCTGGATAATCCGGCCACTTA
CAGGCCTCCTCTGGAGGTCATGTTAACCTACGGTATTGATAACACTCCCA
TCGAATTCTTCGTGGAACTTTCTAAGGACGATGGCAACTTCAATGAACCC
GTCTTTGAGATGGGCGTCTCTGGACACTATGTCAGTCCACATGATAAGCG
GGATGCGTTGAGCCTGGAGTTCCTTGCCACACTTCCGGACTTTGCCTTCT
CGATGGAGTGGCCCAGTAGCTACGAACGGCATATATTCTAGGATAGTTAG
CTAATAAGAATACCAAGTCATTGACACTCCCAAAAAAAAAAAAAAAA

FI02841.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG13160-RA 2848 CG13160-RA 1..2733 1..2733 13650 99.9 Plus
CG13160.a 2851 CG13160.a 1..2736 1..2733 13595 99.8 Plus
CG33012.a 2963 CG33012.a 953..1236 758..1041 520 78.8 Plus
CG33012.a 2963 CG33012.a 2095..2292 1900..2097 285 76.2 Plus
CG33012.a 2963 CG33012.a 709..785 514..590 175 81.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:19:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8259016..8259531 89..604 2520 99.2 Plus
chr2R 21145070 chr2R 8261581..8262073 2031..2523 2435 99.6 Plus
chr2R 21145070 chr2R 8260457..8260842 1136..1521 1870 99 Plus
chr2R 21145070 chr2R 8262126..8262333 2524..2731 1040 100 Plus
chr2R 21145070 chr2R 8261136..8261322 1702..1888 935 100 Plus
chr2R 21145070 chr2R 8260900..8261082 1522..1704 915 100 Plus
chr2R 21145070 chr2R 8259584..8259760 601..777 870 99.4 Plus
chr2R 21145070 chr2R 8260245..8260403 980..1138 795 100 Plus
chr2R 21145070 chr2R 8261375..8261518 1888..2031 720 100 Plus
chr2R 21145070 chr2R 8260060..8260183 860..983 620 100 Plus
chr2R 21145070 chr2R 8259816..8259900 777..861 425 100 Plus
chr2R 21145070 chr2R 8258849..8258937 1..90 385 97.8 Plus
chr2R 21145070 chr2R 8257146..8257265 1900..2019 210 78.3 Plus
chr2R 21145070 chr2R 8255599..8255670 787..858 195 84.7 Plus
chr2R 21145070 chr2R 8255212..8255291 511..590 190 82.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13160-RA 2625 CG13160-PA 1..2625 67..2691 13125 100 Plus
CG13160-RB 2628 CG13160-PB 1..2628 67..2691 13060 99.9 Plus
CG33012-RC 2739 CG33012-PC 547..1539 514..1506 645 71 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:42 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG13160-RA 2733 CG13160-RA 3..2733 1..2731 13640 100 Plus
CG13160-RB 2736 CG13160-RB 3..2736 1..2731 13575 99.9 Plus
CG33012-RC 2849 CG33012-RC 604..1596 514..1506 645 71 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG13160-PA 874 CG13160-PA 1..874 67..2688 4315 100 Plus
CG13160-PB 875 CG13160-PB 1..875 67..2688 4303 99.9 Plus
CG33012-PC 912 CG33012-PC 50..912 115..2688 2778 63 Plus
CG30047-PA 879 CG30047-PA 6..879 79..2688 2347 52.6 Plus
CG30049-PA 878 CG30049-PA 24..878 130..2688 2295 52.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12371764..12372279 89..604 2580 100 Plus
2R 25286936 2R 12374329..12374821 2031..2523 2465 100 Plus
2R 25286936 2R 12373205..12373590 1136..1521 1930 100 Plus
2R 25286936 2R 12374874..12375083 2524..2733 1050 100 Plus
2R 25286936 2R 12373884..12374070 1702..1888 935 100 Plus
2R 25286936 2R 12373648..12373830 1522..1704 915 100 Plus
2R 25286936 2R 12372332..12372508 601..777 885 100 Plus
2R 25286936 2R 12372993..12373151 980..1138 795 100 Plus
2R 25286936 2R 12374123..12374266 1888..2031 720 100 Plus
2R 25286936 2R 12372808..12372931 860..983 620 100 Plus
2R 25286936 2R 12371596..12371685 1..90 435 98.9 Plus
2R 25286936 2R 12372564..12372648 777..861 425 100 Plus
2R 25286936 2R 12369889..12370008 1900..2019 225 79.2 Plus
2R 25286936 2R 12368340..12368411 787..858 195 84.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12372963..12373478 89..604 2580 100 Plus
2R 25260384 2R 12375528..12376020 2031..2523 2465 100 Plus
2R 25260384 2R 12374404..12374789 1136..1521 1930 100 Plus
2R 25260384 2R 12376073..12376282 2524..2733 1050 100 Plus
2R 25260384 2R 12375083..12375269 1702..1888 935 100 Plus
2R 25260384 2R 12374847..12375029 1522..1704 915 100 Plus
2R 25260384 2R 12373531..12373707 601..777 885 100 Plus
2R 25260384 2R 12374192..12374350 980..1138 795 100 Plus
2R 25260384 2R 12375322..12375465 1888..2031 720 100 Plus
2R 25260384 2R 12374007..12374130 860..983 620 100 Plus
2R 25260384 2R 12372795..12372884 1..90 435 98.8 Plus
2R 25260384 2R 12373763..12373847 777..861 425 100 Plus
2R 25260384 2R 12371088..12371207 1900..2019 225 79.1 Plus
2R 25260384 2R 12369539..12369610 787..858 195 84.7 Plus
2R 25260384 2R 12369155..12369231 514..590 175 81.8 Plus
2R 25260384 2R 12366944..12367011 1951..2018 160 82.3 Plus
2R 25260384 2R 12365613..12365681 904..972 150 81.1 Plus
Blast to na_te.dros performed on 2014-11-26 20:19:15 has no hits.

FI02841.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:26:25 Download gff for FI02841.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8262126..8262333 2524..2731 100   Plus
chr2R 8261582..8262073 2032..2523 99 -> Plus
chr2R 8261375..8261518 1888..2031 100 -> Plus
chr2R 8261137..8261321 1703..1887 100 -> Plus
chr2R 8260900..8261080 1522..1702 100 -> Plus
chr2R 8260459..8260842 1138..1521 98 -> Plus
chr2R 8260248..8260402 983..1137 100 -> Plus
chr2R 8260062..8260182 862..982 100 -> Plus
chr2R 8259816..8259900 777..861 100 -> Plus
chr2R 8259585..8259759 602..776 99 -> Plus
chr2R 8259018..8259528 91..601 99 -> Plus
chr2R 8258849..8258937 1..90 97 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:50 Download gff for FI02841.complete
Subject Subject Range Query Range Percent Splice Strand
CG13160-RA 1..2625 67..2691 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:58:11 Download gff for FI02841.complete
Subject Subject Range Query Range Percent Splice Strand
CG13160-RA 1..2625 67..2691 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:01:55 Download gff for FI02841.complete
Subject Subject Range Query Range Percent Splice Strand
CG13160-RA 1..2625 67..2691 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:26:25 Download gff for FI02841.complete
Subject Subject Range Query Range Percent Splice Strand
CG13160-RA 1..2625 67..2691 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-12 17:59:37 Download gff for FI02841.complete
Subject Subject Range Query Range Percent Splice Strand
CG13160-RA 1..2731 1..2731 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:58:11 Download gff for FI02841.complete
Subject Subject Range Query Range Percent Splice Strand
CG13160-RA 1..2731 1..2731 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:01:55 Download gff for FI02841.complete
Subject Subject Range Query Range Percent Splice Strand
CG13160-RA 3..2733 1..2731 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:26:25 Download gff for FI02841.complete
Subject Subject Range Query Range Percent Splice Strand
CG13160-RA 3..2733 1..2731 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:26:25 Download gff for FI02841.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12374874..12375081 2524..2731 100   Plus
2R 12374330..12374821 2032..2523 100 -> Plus
2R 12374123..12374266 1888..2031 100 -> Plus
2R 12373885..12374069 1703..1887 100 -> Plus
2R 12373648..12373828 1522..1702 100 -> Plus
2R 12373207..12373590 1138..1521 100 -> Plus
2R 12372996..12373150 983..1137 100 -> Plus
2R 12372810..12372930 862..982 100 -> Plus
2R 12372564..12372648 777..861 100 -> Plus
2R 12372333..12372507 602..776 100 -> Plus
2R 12371766..12372276 91..601 100 -> Plus
2R 12371596..12371685 1..90 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:01:55 Download gff for FI02841.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8262379..8262586 2524..2731 100   Plus
arm_2R 8261835..8262326 2032..2523 100 -> Plus
arm_2R 8261628..8261771 1888..2031 100 -> Plus
arm_2R 8261390..8261574 1703..1887 100 -> Plus
arm_2R 8261153..8261333 1522..1702 100 -> Plus
arm_2R 8260712..8261095 1138..1521 100 -> Plus
arm_2R 8260501..8260655 983..1137 100 -> Plus
arm_2R 8260315..8260435 862..982 100 -> Plus
arm_2R 8260069..8260153 777..861 100 -> Plus
arm_2R 8259838..8260012 602..776 100 -> Plus
arm_2R 8259271..8259781 91..601 100 -> Plus
arm_2R 8259101..8259190 1..90 98 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:49:48 Download gff for FI02841.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12376073..12376280 2524..2731 100   Plus
2R 12375529..12376020 2032..2523 100 -> Plus
2R 12375322..12375465 1888..2031 100 -> Plus
2R 12375084..12375268 1703..1887 100 -> Plus
2R 12374847..12375027 1522..1702 100 -> Plus
2R 12374406..12374789 1138..1521 100 -> Plus
2R 12374195..12374349 983..1137 100 -> Plus
2R 12374009..12374129 862..982 100 -> Plus
2R 12373763..12373847 777..861 100 -> Plus
2R 12373532..12373706 602..776 100 -> Plus
2R 12372965..12373475 91..601 100 -> Plus
2R 12372795..12372884 1..90 98 -> Plus

FI02841.pep Sequence

Translation from 0 to 2690

> FI02841.pep
SLASGVVKGALAWTVLESLQKKMGATRNGKSLSGSENLIIEVDEDKIRCK
QYSWYFAPIYLLFWVGLFFAVIYPLFQALPTGIKISEEADKPGQFVAERA
QEILLQISRLGPRVVGDVDNEVTVVNLLLAEIEKVRQVLRDDVYEMEVEV
QRASGSYLIKGLTNHYQGVQNVIVRLSTKSSNSTSYLLVNSHYDTKPGSP
GAGDDAAMVVVMLEVLRLVAVSGDPFLHPIIFLFNGAEEQPMQGSHGFIT
QHRWAANCKALLNLDSAGAGGRDLLFQGGPNHPWLMEHYRNSAPHPFATT
TAEEMFEAGIIPSDTDFRIFRDFGVVPGLDMAGVYNGFVYHTKFDRYAVI
SLDSLQNSGDNLLALVWSISNAEEMYDTEAHAAGHAVFFDFIGLFFVHYQ
ESTSLALNLFFSFGAILLVCISLWRMSRVTGQTMGTYAGVFGLLFLLALA
GALLAVAFPLLMATFYDWGNRTLTYFSNSWLVIGLYICPSVIGLVLPMTL
YLTHTKCNKIPHTYYLHIVGHANCVLLAILCLGATALKYRSAYLFLISLI
FYVAALIINLLTRLHCRGYLWSLVLIVFQIIPFIYHAYLFHMFILILIPM
TGRFGVSTNPDILIGALCGFGTILALSFAAPLINVFRRPNCMLGGLALVM
FIFCMIAVSDVGFPYRPKTNVMRADFMQVHRKFFEYNGSISHEDSGYYFH
LGDRNKEAPLRDHMNLTNLVRLGEDCDSELMCGIPCYRYCSAREHALWLA
REEPVELPYPTVLEFLSKTVLSGGYQVRYEFRLTGPPNMGLFFKPLDGVK
LLRWTFAPAMLDNPATYRPPLEVMLTYGIDNTPIEFFVELSKDDGNFNEP
VFEMGVSGHYVSPHDKRDALSLEFLATLPDFAFSMEWPSSYERHIF*

FI02841.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:00:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12850-PA 803 GF12850-PA 5..770 31..795 3242 78.3 Plus
Dana\GF12849-PA 931 GF12849-PA 72..931 41..896 2964 63 Plus
Dana\GF12845-PA 879 GF12845-PA 7..879 33..896 2426 52.8 Plus
Dana\GF12847-PA 878 GF12847-PA 17..878 36..896 2411 50.5 Plus
Dana\GF12846-PA 878 GF12846-PA 2..878 21..896 2287 49.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20284-PA 875 GG20284-PA 1..874 23..895 4289 93.5 Plus
Dere\GG20280-PA 875 GG20280-PA 14..875 38..896 2421 52.6 Plus
Dere\GG20282-PA 878 GG20282-PA 26..878 47..896 2357 52 Plus
Dere\GG20283-PA 828 GG20283-PA 166..828 200..896 2264 59.3 Plus
Dere\GG20281-PA 782 GG20281-PA 3..782 120..896 2227 52.8 Plus
Dere\GG20283-PA 828 GG20283-PA 5..173 166..334 681 73.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20689-PA 879 GH20689-PA 17..879 36..896 3075 64.1 Plus
Dgri\GH20688-PA 859 GH20688-PA 2..859 42..896 2561 53.7 Plus
Dgri\GH20685-PA 871 GH20685-PA 13..871 40..896 2052 46.2 Plus
Dgri\GH20682-PA 862 GH20682-PA 8..862 41..896 1849 42.4 Plus
Dgri\GH20679-PA 891 GH20679-PA 48..887 50..892 1759 40.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:00:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG13160-PA 874 CG13160-PA 1..874 23..896 4611 100 Plus
CG13160-PB 875 CG13160-PB 1..875 23..896 4599 99.9 Plus
CG33012-PC 912 CG33012-PC 50..912 39..896 2969 63 Plus
CG30047-PA 879 CG30047-PA 6..879 27..896 2526 52.6 Plus
CG30049-PA 878 CG30049-PA 24..878 44..896 2463 52.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19051-PA 855 GI19051-PA 6..855 40..896 2626 56.1 Plus
Dmoj\GI19050-PA 761 GI19050-PA 1..761 139..896 2310 56.1 Plus
Dmoj\GI19047-PA 867 GI19047-PA 9..867 32..896 2077 46 Plus
Dmoj\GI19049-PA 872 GI19049-PA 9..872 32..896 2022 44.5 Plus
Dmoj\GI18384-PA 875 GI18384-PA 1..875 32..896 1983 44.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11627-PA 878 GL11627-PA 1..878 23..896 3537 73.1 Plus
Dper\GL11626-PA 902 GL11626-PA 36..902 35..896 3077 64.9 Plus
Dper\GL11623-PA 881 GL11623-PA 5..881 28..896 2558 53.2 Plus
Dper\GL11625-PA 879 GL11625-PA 27..879 48..896 2486 52.5 Plus
Dper\GL11624-PA 879 GL11624-PA 1..879 19..896 2389 51.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12087-PA 880 GA12087-PA 1..880 23..896 3517 72.7 Plus
Dpse\GA24798-PA 902 GA24798-PA 36..902 35..896 3080 64.9 Plus
Dpse\GA15604-PA 881 GA15604-PA 5..881 28..896 2569 53.4 Plus
Dpse\GA15600-PA 879 GA15600-PA 27..879 48..896 2481 52.6 Plus
Dpse\GA24797-PA 879 GA24797-PA 1..879 19..896 2394 51.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21371-PA 856 GM21371-PA 1..856 23..896 4336 95.7 Plus
Dsec\GM21370-PA 927 GM21370-PA 43..927 33..896 2852 60.7 Plus
Dsec\GM21365-PA 878 GM21365-PA 1..878 23..896 2464 52 Plus
Dsec\GM21368-PA 878 GM21368-PA 26..877 47..895 2300 52.4 Plus
Dsec\GM21367-PA 794 GM21367-PA 1..794 85..896 2157 49.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10868-PA 852 GD10868-PA 1..852 23..896 4319 94.9 Plus
Dsim\GD10867-PA 909 GD10867-PA 40..909 33..896 3002 63.7 Plus
Dsim\GD10862-PA 879 GD10862-PA 6..879 27..896 2480 52.6 Plus
Dsim\GD10864-PA 878 GD10864-PA 27..878 48..896 2349 52.6 Plus
Dsim\GD10863-PA 762 GD10863-PA 1..762 85..896 2037 48.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20020-PA 885 GJ20020-PA 23..885 36..896 3101 64.9 Plus
Dvir\GJ20019-PA 879 GJ20019-PA 34..878 54..895 2570 55.5 Plus
Dvir\GJ21461-PA 872 GJ21461-PA 31..872 54..896 2093 48 Plus
Dvir\GJ20017-PA 877 GJ20017-PA 7..877 14..896 2085 46.7 Plus
Dvir\GJ20015-PA 1217 GJ20015-PA 345..1217 28..896 2069 45.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14799-PA 882 GK14799-PA 20..882 35..896 3045 64.2 Plus
Dwil\GK23157-PA 883 GK23157-PA 1..883 23..896 2879 60 Plus
Dwil\GK23251-PA 904 GK23251-PA 54..904 45..896 2432 52.7 Plus
Dwil\GK20845-PA 877 GK20845-PA 22..877 44..896 2082 47 Plus
Dwil\GK20846-PA 877 GK20846-PA 9..877 28..896 2006 44.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12444-PA 875 GE12444-PA 1..875 23..896 4384 95 Plus
Dyak\GE12443-PA 910 GE12443-PA 40..910 33..896 2960 63.6 Plus
Dyak\GE12439-PA 878 GE12439-PA 6..878 27..896 2441 52.2 Plus
Dyak\GE12441-PA 878 GE12441-PA 19..878 40..896 2401 52.1 Plus
Dyak\GE12440-PA 815 GE12440-PA 1..815 85..896 2365 53.6 Plus

FI02841.hyp Sequence

Translation from 1 to 2690

> FI02841.hyp
SRASGVVKGALAWTVLESLQKKMGATRNGKSLSGSENLIIEVDEDKIRCK
QYSWYFAPIYLLFWVGLFFAVIYPLFQALPTGIKISEEADKPGQFVAERA
QEILLQISRLGPRVVGDVDNEVTVVNLLLAEIEKVRQVLRDDVYEMEVEV
QRASGSYLIKGLTNHYQGVQNVIVRLSTKSSNSTSYLLVNSHYDTKPGSP
GAGDDAAMVVVMLEVLRLVAVSGDPFLHPIIFLFNGAEEQPMQGSHGFIT
QHRWAANCKALLNLDSAGAGGRDLLFQGGPNHPWLMEHYRNSAPHPFATT
TAEEMFEAGIIPSDTDFRIFRDFGVVPGLDMAGVYNGFVYHTKFDRYAVI
SLDSLQNSGDNLLALVWSISNAEEMYDTEAHAAGHAVFFDFIGLFFVHYQ
ESTSLALNLFFSFGAILLVCISLWRMSRVTGQTMGTYAGVFGLLFLLALA
GALLAVAFPLLMATFYDWGNRTLTYFSNSWLVIGLYICPSVIGLVLPMTL
YLTHTKCNKIPHTYYLHIVGHANCVLLAILCLGATALKYRSAYLFLISLI
FYVAALIINLLTRLHCRGYLWSLVLIVFQIIPFIYHAYLFHMFILILIPM
TGRFGVSTNPDILIGALCGFGTILALSFAAPLINVFRRPNCMLGGLALVM
FIFCMIAVSDVGFPYRPKTNVMRADFMQVHRKFFEYNGSISHEDSGYYFH
LGDRNKEAPLRDHMNLTNLVRLGEDCDSELMCGIPCYRYCSAREHALWLA
REEPVELPYPTVLEFLSKTVLSGGYQVRYEFRLTGPPNMGLFFKPLDGVK
LLRWTFAPAMLDNPATYRPPLEVMLTYGIDNTPIEFFVELSKDDGNFNEP
VFEMGVSGHYVSPHDKRDALSLEFLATLPDFAFSMEWPSSYERHIF*

FI02841.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG13160-PA 874 CG13160-PA 1..874 23..896 4611 100 Plus
CG13160-PB 875 CG13160-PB 1..875 23..896 4599 99.9 Plus
CG33012-PC 912 CG33012-PC 50..912 39..896 2969 63 Plus
CG30047-PA 879 CG30047-PA 6..879 27..896 2526 52.6 Plus
CG30049-PA 878 CG30049-PA 24..878 44..896 2463 52.5 Plus