Clone FI02888 Report

Search the DGRC for FI02888

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:88
Vector:pFlc-1
Associated Gene/TranscriptLig4-RA
Protein status:FI02888.pep: gold
Sequenced Size:3053

Clone Sequence Records

FI02888.complete Sequence

3053 bp assembled on 2009-01-14

GenBank Submission: BT057979.1

> FI02888.complete
GACATTGCTTGAACAGATGTTCACAGTGATGAAATTGTTTACAACAGTAT
ATTGTTTTTAAACAACAAAATGAGCGTAGATATAGCCAGCACGATCAAGT
TCCGGGATATTTGCAGCCTGTTCGAGAAGATTAAGGCCACGCAAAAGGTG
GCTAACAAGGAGGAGGTCCTCAAGAGCTACTACGAGTCCTTCTGTCGCCA
CCGCGAATCCTTTCGCCGGCAAACCGGATTAAACAACGACCAGCCGGAGG
ACGGTGCCAGTAGCTTCTATTCCGTGCTGCGACTGCTGCTTCCGGGTGCG
GACACTGGTCGGGATACCTATGGATTGCAGATCACCGCGCTGGGCAGGCT
CTACATCAGGGTGCTCCAGCTACCCACGGACTCCAGCGATGCCATCAGGC
TGCAGCACCGCAACGGAAACATGTACCGGGACTACGGTGATGTTGTTTAT
TCCGTGCTTAAGCCAAGGTGCTTTAATCCGCCCAGCAATTTGAGACTGAA
AGAAATCCATCAGATGCTGGACACCATTGCCAACGAGGACACAGAAGTTA
AGCAGCAGCAACTCATCCGGTTTACGGAGCAGGCCTCGCCTGAGGAACAG
AAGTGGCTAATTCGGTTGCTGCTTAAGAGCCTCGGGCTGGGGATCGGTGA
GCAAAAGATTTTCGGTGTGCTGCACCCCAAGGCGCAGGATATCTACCAGC
GCTGCTCCGATCTGGGACATGTGTGCAATCTGCTGGCAGACCGAACCACC
GACCTAGACGCCAGCAGCAGCAAGGACAGCAAGGCGGCGGTCAAGTTTGT
AAACCTGAATTCCGTCATACGGCCATTCCACCAGATACGTCCCATGCTGT
GCGAACGATTCCCCGGTGACATCCAGGAGCTGATGCAGTCGGATGTGCTC
TATCTGGAGACCAAAATGGATGGCGAACGCTTTCAGCTGCACATCGATCG
GGGTCGTTTCATGTACATTTCCCGCAATGGAGTGGACTACACCAGAAACT
TTGGTCACAGCTACGATCACGGCACCTTAACGCCAAAGCTGAGGGGACTT
CTGCCGCTGGGTCTGGAGTCTATCATACTCGACGGCGAGATGATGGTGTG
GGATACCAACAAACTGCGCTTTCGGGAAAAAGGCGAGAATACGGACGTGA
AGAGCCTGAAGCCGGAGGGCAGCTGGCAGCCATGTTTCGTGGTGTACGAT
CTGCTATATTTTAATGGCCAGAGTCTGCTGGACCATACCTACATTCAGCG
GGCGTACAAATTGCAGAAACTCATAGTTGAACAGTCGGGTGTGCTGCAGT
TGATGCGTGCACGCAAAATCGGTTCCGTTCAAGAGTTCAACGAGCTGTTC
CAGCAGGCACTCGACTCCCACGCCGAGGGCATTGTGCTAAAGAAGCAGGG
ATCAAGATATCAGCCTGGCGTTAGACTGGGCGGTGGGTGGTACAAGGACA
AGGCTGATTACATCAAAGGGCTGATCACCGAGTTCGATGTGCTGATCATC
GGGGCATTCTACAATCGCAAGCGCACCTTTGTGGACTCATTTTTACTGGG
CGTTCTCCAGCCGGCGCCGCCAGGCAGCTCTAATCGTCCCGAAGTCTTCA
GTATTGGAGTGGTTGCCAACAATACGAAACAGCGCGGAGTGCTAAATCAC
ACACTGAAACCACATTGGCATGATGTAGTCAATGAGCCACCGCCATTGTG
GTTTCACTACAAGCCCAAGGAGAGGTCCGGATGCCCCGATCTGTGGATTG
AACCGCAGAACTCGGTAATTTTGCAGGTGAAAGCTGCTGATCTGGCGCCC
AATGGAGCATTTTTCACCCGAAAATCGTTGCACTTTCCGCGCACTGAGAT
GAAACGGGATGATAAGACCTGGAGCGAGTGTATGACACTTAAGGAGTTTA
ACGATCTCTGCGGAGGTCCTTTGGCCATCAAGAAGTTAAACAAGCGGCAA
CTGCGACTAGAGGATGTGACCACCAAGCGGAAACAGATGCGTATGACGCC
CTCGGAGCGAAGCCGACTGGGATTGGCCGTCTATGAGAAGCGCTATGACG
CTAGCACCTCCGCTAGCACTTCCAAACTTTTCGACGGTCTGAGCTTTTGC
ATTCTGAGCGGATCTGCCGGACGACACAGCAAGCATCAGCTGCAGGAGCT
GGCTGTTAAAAACGGTGGCTGCATCGTGGAAAATCCCCTGCCCAATGATC
CAAAGTGTTTTTGCATCGCAGGCGATGAGACGTTTTTAGTTAAGCGGCTC
ATCCTTCAACAGCCACGCACCTGTGACATTGTGCGCATGGAGTGGCTACT
TAGGGTCTGTCAGAAGCAGGAGCTTGAACTAAAGCCTAGAGATCTTATTG
CGGCCACTGAACCACTGCAGCAGGATCTGGCTGAATGTTTTGATCGGCAC
GGTGATAGCTACACCAAAGACATTGCCAACGTGGAGGAGCTGCAGGATCT
GCTTCAAGGCATTGAGTTGACAGCTGATAATGTGGCTGGCATAACCGCAT
CTAATCTCAATGCTCTGGAGGATCAGCTTCTGGATGGGAAAAAGAATCTG
AACATGTTCCGCAACCTTAATGCGTTCTTCTACAGTCCGCATGGTGATGA
AGTGGCTAAGCTTCTGTTTCTTCAAAACGGCGGCCGGATAGTCGACGATT
CCGATCCGCAACTAAATCTGGGATTTATCTGTATGTCTTCTGACATCGAT
AACGACCACTTCGAGCACTGGCTGCACAATCATTCCAAGTTGACCACTGA
CAAGGTCTTAAACTCGGCGTGGATACATCAGTGCCATCGCGAAGGCATCC
TACTTCCTATGCATTCTTTCGTCTAACTCAATGAGTTTTTCACGCTTTAT
AGTTTTGTACAAAAATTACCTGTTATCCTTGTTATAAAATTGTTGTTTCA
TTGACATTTTTCTTACCATAAAAAGCTTTAAACAGAAGTCATTCCGAATT
TAATGTTATATCAAAAAGATTTTCATGGATAATTTGCTTCAATAAAGTGA
AACATAGAATAACAATAGTAGAATGACAATAAGTACGCAAAAAAAAAAAA
AAA

FI02888.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Lig4.a 3971 Lig4.a 22..3064 2..3044 15215 100 Plus
Lig4-RA 3118 Lig4-RA 82..3118 2..3038 15185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13555313..13556892 3038..1459 7900 100 Minus
chrX 22417052 chrX 13556955..13557867 1458..546 4565 100 Minus
chrX 22417052 chrX 13558157..13558537 382..2 1905 100 Minus
chrX 22417052 chrX 13557925..13558089 547..383 825 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
Lig4-RA 2757 CG12176-PA 1..2757 70..2826 13785 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:11 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:43:07
Subject Length Description Subject Range Query Range Score Percent Strand
Lig4-RA 3040 CG12176-RA 4..3040 2..3038 15185 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
Lig4-PA 918 CG12176-PA 1..918 70..2823 4678 100 Plus
DNA-ligI-PA 747 CG5602-PA 361..709 817..1866 227 25.3 Plus
lig3-PA 806 CG17227-PA 77..642 277..2007 210 23.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13664578..13666163 3044..1459 7930 100 Minus
X 23542271 X 13666226..13667138 1458..546 4565 100 Minus
X 23542271 X 13667428..13667808 382..2 1905 100 Minus
X 23542271 X 13667196..13667360 547..383 825 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:36:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13672676..13674261 3044..1459 7930 100 Minus
X 23527363 X 13674324..13675236 1458..546 4565 100 Minus
X 23527363 X 13675526..13675906 382..2 1905 100 Minus
X 23527363 X 13675294..13675458 547..383 825 100 Minus
Blast to na_te.dros performed 2014-11-27 11:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 203..241 2909..2871 132 82.1 Minus
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 2983..3021 2909..2871 132 82.1 Minus

FI02888.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:54:07 Download gff for FI02888.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13558157..13558537 1..382 99   Minus
chrX 13557925..13558089 383..547 100 <- Minus
chrX 13556955..13557865 548..1458 100 <- Minus
chrX 13555313..13556892 1459..3038 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:58:50 Download gff for FI02888.complete
Subject Subject Range Query Range Percent Splice Strand
Lig4-RA 1..2757 70..2826 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:28:06 Download gff for FI02888.complete
Subject Subject Range Query Range Percent Splice Strand
Lig4-RA 1..2757 70..2826 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:30:56 Download gff for FI02888.complete
Subject Subject Range Query Range Percent Splice Strand
Lig4-RA 1..2757 70..2826 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:54:07 Download gff for FI02888.complete
Subject Subject Range Query Range Percent Splice Strand
Lig4-RA 1..2757 70..2826 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-14 09:35:05 Download gff for FI02888.complete
Subject Subject Range Query Range Percent Splice Strand
Lig4-RA 1..3037 2..3038 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:28:05 Download gff for FI02888.complete
Subject Subject Range Query Range Percent Splice Strand
Lig4-RA 1..3037 2..3038 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:30:56 Download gff for FI02888.complete
Subject Subject Range Query Range Percent Splice Strand
Lig4-RA 3..3040 1..3038 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:54:07 Download gff for FI02888.complete
Subject Subject Range Query Range Percent Splice Strand
Lig4-RA 3..3040 1..3038 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:54:07 Download gff for FI02888.complete
Subject Subject Range Query Range Percent Splice Strand
X 13667428..13667808 1..382 99   Minus
X 13667196..13667360 383..547 100 <- Minus
X 13666226..13667136 548..1458 100 <- Minus
X 13664584..13666163 1459..3038 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:30:56 Download gff for FI02888.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13561461..13561841 1..382 99   Minus
arm_X 13561229..13561393 383..547 100 <- Minus
arm_X 13560259..13561169 548..1458 100 <- Minus
arm_X 13558617..13560196 1459..3038 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:00:48 Download gff for FI02888.complete
Subject Subject Range Query Range Percent Splice Strand
X 13675526..13675906 1..382 99   Minus
X 13675294..13675458 383..547 100 <- Minus
X 13674324..13675234 548..1458 100 <- Minus
X 13672682..13674261 1459..3038 100 <- Minus

FI02888.pep Sequence

Translation from 69 to 2825

> FI02888.pep
MSVDIASTIKFRDICSLFEKIKATQKVANKEEVLKSYYESFCRHRESFRR
QTGLNNDQPEDGASSFYSVLRLLLPGADTGRDTYGLQITALGRLYIRVLQ
LPTDSSDAIRLQHRNGNMYRDYGDVVYSVLKPRCFNPPSNLRLKEIHQML
DTIANEDTEVKQQQLIRFTEQASPEEQKWLIRLLLKSLGLGIGEQKIFGV
LHPKAQDIYQRCSDLGHVCNLLADRTTDLDASSSKDSKAAVKFVNLNSVI
RPFHQIRPMLCERFPGDIQELMQSDVLYLETKMDGERFQLHIDRGRFMYI
SRNGVDYTRNFGHSYDHGTLTPKLRGLLPLGLESIILDGEMMVWDTNKLR
FREKGENTDVKSLKPEGSWQPCFVVYDLLYFNGQSLLDHTYIQRAYKLQK
LIVEQSGVLQLMRARKIGSVQEFNELFQQALDSHAEGIVLKKQGSRYQPG
VRLGGGWYKDKADYIKGLITEFDVLIIGAFYNRKRTFVDSFLLGVLQPAP
PGSSNRPEVFSIGVVANNTKQRGVLNHTLKPHWHDVVNEPPPLWFHYKPK
ERSGCPDLWIEPQNSVILQVKAADLAPNGAFFTRKSLHFPRTEMKRDDKT
WSECMTLKEFNDLCGGPLAIKKLNKRQLRLEDVTTKRKQMRMTPSERSRL
GLAVYEKRYDASTSASTSKLFDGLSFCILSGSAGRHSKHQLQELAVKNGG
CIVENPLPNDPKCFCIAGDETFLVKRLILQQPRTCDIVRMEWLLRVCQKQ
ELELKPRDLIAATEPLQQDLAECFDRHGDSYTKDIANVEELQDLLQGIEL
TADNVAGITASNLNALEDQLLDGKKNLNMFRNLNAFFYSPHGDEVAKLLF
LQNGGRIVDDSDPQLNLGFICMSSDIDNDHFEHWLHNHSKLTTDKVLNSA
WIHQCHREGILLPMHSFV*

FI02888.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 17:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21760-PA 924 GF21760-PA 1..920 1..914 3879 77.2 Plus
Dana\GF17047-PA 788 GF17047-PA 72..597 70..613 256 24.8 Plus
Dana\GF12871-PA 749 GF12871-PA 226..711 128..599 247 24.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 17:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19495-PA 927 GG19495-PA 1..918 1..918 4686 94 Plus
Dere\GG17130-PA 805 GG17130-PA 77..602 70..613 264 24.5 Plus
Dere\GG22898-PA 747 GG22898-PA 162..709 59..599 250 23.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 17:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11911-PA 922 GH11911-PA 1..918 3..917 3118 62.6 Plus
Dgri\GH20153-PA 799 GH20153-PA 57..587 70..613 286 24.5 Plus
Dgri\GH20192-PA 674 GH20192-PA 160..637 138..600 235 24 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 17:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
Lig4-PA 918 CG12176-PA 1..918 1..918 4840 100 Plus
DNA-ligI-PA 747 CG5602-PA 224..709 128..599 256 23.4 Plus
lig3-PA 806 CG17227-PA 77..642 70..646 251 23.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 17:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15517-PA 926 GI15517-PA 7..923 2..918 3100 61.7 Plus
Dmoj\GI20719-PA 736 GI20719-PA 223..699 138..600 282 25.1 Plus
Dmoj\GI24375-PA 793 GI24375-PA 57..579 70..614 274 25 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 17:05:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22420-PA 916 GL22420-PA 1..913 3..917 3686 73.9 Plus
Dper\GL11174-PA 744 GL11174-PA 221..707 128..600 264 24.3 Plus
Dper\GL27179-PA 788 GL27179-PA 57..584 70..613 251 25 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 17:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11455-PA 916 GA11455-PA 1..913 3..917 3683 73.9 Plus
Dpse\GA18999-PA 744 GA18999-PA 221..707 128..600 261 24.3 Plus
Dpse\GA26759-PA 788 GA26759-PA 57..584 70..613 243 24.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 17:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17599-PA 671 GM17599-PA 1..669 118..786 3557 98.2 Plus
Dsec\GM17600-PA 90 GM17600-PA 1..90 829..918 437 87.8 Plus
Dsec\GM26013-PA 783 GM26013-PA 57..763 70..743 290 24.4 Plus
Dsec\GM16058-PA 747 GM16058-PA 234..709 138..599 249 24.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 17:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11806-PA 713 GD11806-PA 327..675 250..599 231 26.4 Plus
Dsim\GD20571-PA 362 GD20571-PA 57..359 70..386 170 26 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 17:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19276-PA 992 GJ19276-PA 1..887 3..888 3085 64.3 Plus
Dvir\GJ24382-PA 818 GJ24382-PA 77..606 70..613 259 24 Plus
Dvir\GJ20456-PA 667 GJ20456-PA 154..630 138..600 245 24.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 17:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10206-PA 935 GK10206-PA 1..930 3..917 2946 61.6 Plus
Dwil\GK11194-PA 796 GK11194-PA 56..574 70..613 298 25.5 Plus
Dwil\GK15713-PA 744 GK15713-PA 159..707 59..600 240 24.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 17:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16147-PA 918 GE16147-PA 1..918 1..918 4668 93.4 Plus
Dyak\GE24522-PA 785 GE24522-PA 57..582 70..613 277 25.5 Plus
Dyak\GE14336-PA 747 GE14336-PA 224..709 128..599 258 24.3 Plus

FI02888.hyp Sequence

Translation from 69 to 2825

> FI02888.hyp
MSVDIASTIKFRDICSLFEKIKATQKVANKEEVLKSYYESFCRHRESFRR
QTGLNNDQPEDGASSFYSVLRLLLPGADTGRDTYGLQITALGRLYIRVLQ
LPTDSSDAIRLQHRNGNMYRDYGDVVYSVLKPRCFNPPSNLRLKEIHQML
DTIANEDTEVKQQQLIRFTEQASPEEQKWLIRLLLKSLGLGIGEQKIFGV
LHPKAQDIYQRCSDLGHVCNLLADRTTDLDASSSKDSKAAVKFVNLNSVI
RPFHQIRPMLCERFPGDIQELMQSDVLYLETKMDGERFQLHIDRGRFMYI
SRNGVDYTRNFGHSYDHGTLTPKLRGLLPLGLESIILDGEMMVWDTNKLR
FREKGENTDVKSLKPEGSWQPCFVVYDLLYFNGQSLLDHTYIQRAYKLQK
LIVEQSGVLQLMRARKIGSVQEFNELFQQALDSHAEGIVLKKQGSRYQPG
VRLGGGWYKDKADYIKGLITEFDVLIIGAFYNRKRTFVDSFLLGVLQPAP
PGSSNRPEVFSIGVVANNTKQRGVLNHTLKPHWHDVVNEPPPLWFHYKPK
ERSGCPDLWIEPQNSVILQVKAADLAPNGAFFTRKSLHFPRTEMKRDDKT
WSECMTLKEFNDLCGGPLAIKKLNKRQLRLEDVTTKRKQMRMTPSERSRL
GLAVYEKRYDASTSASTSKLFDGLSFCILSGSAGRHSKHQLQELAVKNGG
CIVENPLPNDPKCFCIAGDETFLVKRLILQQPRTCDIVRMEWLLRVCQKQ
ELELKPRDLIAATEPLQQDLAECFDRHGDSYTKDIANVEELQDLLQGIEL
TADNVAGITASNLNALEDQLLDGKKNLNMFRNLNAFFYSPHGDEVAKLLF
LQNGGRIVDDSDPQLNLGFICMSSDIDNDHFEHWLHNHSKLTTDKVLNSA
WIHQCHREGILLPMHSFV*

FI02888.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
Lig4-PA 918 CG12176-PA 1..918 1..918 4840 100 Plus
DNA-ligI-PA 747 CG5602-PA 224..709 128..599 256 23.4 Plus
lig3-PA 806 CG17227-PA 77..642 70..646 251 23.8 Plus