Clone FI03206 Report

Search the DGRC for FI03206

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:32
Well:6
Vector:pFlc-1
Associated Gene/TranscriptCASK-RA
Protein status:FI03206.pep: gold
Sequenced Size:3990

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Caki 2008-12-18 5.12 accounting

Clone Sequence Records

FI03206.complete Sequence

3990 bp assembled on 2008-09-19

GenBank Submission: BT044550.1

> FI03206.complete
AGTTTAACGCGAGCCCTTGCCTGGACAGCACGGCCAGTGCAAGCAAAAAA
AGCTAAATAAATTAAAACAATAAAGAACAAAAAATATGTACTCCTTAATT
CATTAAAGCAGAAAAACCCCTGAAAACACACAACGAGTTAGATACGCACA
ACAACAACATTTCGTTGCAAAATCGCATGCTAGAAAATTTGAAAATATAA
AAGCTAAACCAAAAAACCAAAACAAAATCAATTCAAAATTAAATTCAAAA
AGTTGCATCAAATTAAAACACACACACATCTATATAGAGAACTCAATAAT
AAAGCAAGATTAAAACCAAGTTAAACCCCAAATACAACAAATTAATTACA
ATTGTGATGAACAAGTTAATTGCATCAATTGCAGCACATAAAAACTAAAG
CATTAAAAATAGCCTAAATCGAACAAAAGTATATATTTGCTGCCCAGGCA
GGCTCAATTAAAAAGGATACAATAATTTATTGCCACATCAACTCAGCGTC
GTGGGATGCAGATGCGAATGCACATACAGATGCAGATGCACATTGGATAT
TGGACGAATCGGACACATTATATTACCAGTGATAGCAACAGAATTTACAT
AACCATTAATGAATAATAGACAACAGTAATAAGCAAGCCCCAACAAAAAC
CCCGACAAACCAAATTGTTGTAGACTATAAAGCATCGCCCAGTTTCTTGT
TGTTGATTAATCATAATTAAATAGAAGTTGTTGTTGGAAAAGCTGTGATC
GCAGAAGGGAGTCTACGCGGATGACACACATGACAAAGCAAAAACCATTG
TTAACAAACCGAAACAATACAGAGAGTTAAAACCATAAACCTGTAAGCAA
TGCTTGTTGGCCCAAACGCTGAACACAGTGAGAACAGCATAAGCCACATC
AGCACACTGACACTGGCACTGGCAGCTCCTGGCCTAAACCACATATCAAG
AGGCTAGAACGTGCTGCGCAGCGCAGGGGGGAGCAAACCAAGAAATCCCC
CAAAGGACACAACATTTACCCGCGCCACTCGTCGTCACCGCCCCCGCATC
GCCTGCAATGCTCTGGTAGCCAAGACAGTTTTACGGTGGATCACTACTGC
GCCGGCGGCGACCCACAAGCAGCGGCGGCATCTGGACCTGGAGCGGCTGG
ATCTGGAGCGGGCGGCGGGCCATCGCAGCAGGCGGGTCAATGGTCCAATG
CGGCGATCGGCGGCGGCGTGACCTCTTGCGGCGGCGGCGTCGGTGGCGGA
ATAGTGCCCCAATCCCACCATCCCATTGGCATGTGCCAGCATCATGGGCT
GACATCACAGTCGTTGATGTCCGGTGGCTCGCACATATCCCTGCTGGGCA
GCAGCGGCAGCAGCGGTATGAGCGGCAGCGGCGTCGGCAGCAGCGGTCAG
AGTGTCCCGCAATGTCCCGCCGCTGTGGCAGCCGCGGATGCCGCAATGAT
GGGCTCCAATGCCGGCGGCCATTGCCGCAGCCTGAGCGGCCTGAGCTCGA
TCAGCATACCGCCGCCGCCGCCGGCGCTCTTCAATCCGTGCAGCTCGGCG
CTGTCGCTGCAGCAGGCGGCGGTAACCAGGTGGGGACCGCGCACCTCCTG
CCCGGTCCACAGTCCGTTTCGTGTGCGCGTGCCGAACGGCTCCATCTGCT
CCGGACACCAGGCTCTGCTCCATAGCCACGATGTGGTGGCCCGGGATGTC
TACGGGGAGGAGGCGCTGCGCGTCACCCCGCCCCCGATGGTGCCCTACCT
CAATGGCGACGAGCTGGACAACGTCGAGGGCGGCGAACTGCAGCATGTGA
CCCGGGTGCGACTGGTGCAGTTTCAGAAGAACACGGACGAGCCCATGGGC
ATCACGCTGAAGATGACCGAGGACGGGCGGTGCATTGTGGCCAGGATTAT
GCACGGCGGGATGATTCATCGCCAGGCCACGCTGCACGTGGGCGACGAGA
TACGGGAGATCAACGGCCAGCCGGTGCAGCACCAGTCGGTTGGCCAATTG
CAACGAATGCTGCGCGAGGCACGCGGTTCTGTTACCTTCAAGATAGTTCC
TTCGTACCGCAGCGCTCCGCCCCCCTGCGAGCTTTTCAGGATCAGACCCG
CTCCGGTGCTTATATTCGTGCGCGCCCAATTCGATTATAATCCGCTGGAT
GATGAGCTTATACCCTGCGCCCAGGCGGGCATATCGTTCCAAGTGGGCGA
TATACTGCAGATTATTAGCAAGGACGATCATCACTGGTGGCAGGCGCGAC
TGGACACGGTGGGCGGATCGGCCGGACTGATACCGTCGCCGGAGCTGCAG
GAGTGGCGGATCGCCTGCCAGACGGTCGACAAGACCAAGCAGGAGCAGGT
TAACTGCTCCATCTTCGGGCGCAAGAAGAAGCAATGCCGGGACAAATATC
TGGCCAAGCACAATGCCATCTTCGACACGCTCGATGTGGTCACGTACGAG
GAGGTTGTCAAGGTGCCAGTTGGCGACCCGAACTTTCAGCGCAAAACGTT
GGTGCTCTTGGGTGCTCATGGGGTGGGCAGGCGGCACATTAAGAACACCT
TGATATCGAAGTACCCCGACAAGTACGCCTATCCCATACCACATACAACG
AGACCTGCCAAACCCGAGGAGGAGAACGGACGCAGCTATTACTTTGTCTC
GCACGATGAAATGATGGCGGACATCGGTGCGAATGAGTACTTGGAATACG
GCACCCACGAGGATGCCATGTACGGCACCAAGTTGGACACCATCCGACGG
ATTCACACCGAGGGCAAGATGGCCATATTGGATGTGGAGCCGCAGGCACT
AAAAATACTCCGCACCGCCGAGTTCACGCCCTATGTCGTGTTTATAGCGG
CGCCCTCACTGCAGAACATAGCAGATTACGACGGCAGCCTGGAGCGACTG
GCCAAGGAGTCGGAGATGCTGCGCCAGCTATACGGTCACTTCTTCGATCT
GACGATTGTGAACAACGATATTAGCGAGACGATTGCCACGCTGGAGACGG
CCATCGACCGGGTGCATACCACCCCGCAGTGGGTGCCCGTATCCTGGCTG
TACTGACAAGACAGCGAACTGGAATGCCCCGACTGCCTCGAGGGCTGTGA
ATGCGAGTGGGAAGCCTACACACAGGCCTCCAACGTAGCCCTATACTGAG
GCACAGATGCAGATGCGCACGACGATGCAGATACACGCCACATCACCACA
CCACACACACCATTAAAGTATTACCAAGGCACAAGCAACAGCAACTGAAG
AAGCAACACAGCAACCACTACGAGAGATGACAGTCAGGACTGGAGGATAG
AAGGCGCCTGGCGCCGAGCTATATAATTTAAGAATAAATGGGTATTATGG
GAACTGCGGTCGCAACGCAATGACAAAAGTGTGTGTTAAACGACAAACAA
CCATTTGTATTTGCCTCTTATTTGTTTTCTGTTTTAACAGTATGTTTATT
TTGTATTAATTTTAATCGATTGTATTTGCCATTCCATGCTCAATGTGTTA
TATTTTACGATTATTGTTTTGTTGTATTTGTTTTATTCAGCATTTAGTCA
AAACAGCATTAAACGCTTATGTAAATCTTGCACTTGTTAGTGTCTAAGTT
AAATGGAGTTAGACAAATCGAAACTGAAGCACTCCAAATTGTTTTTACCT
AATGATTATTTCCGGTAAGAGTCTTGTGTGCAGGTAGGGCGTCGAACGAG
TTAGTAAATTATAGAAAAACTACGTAATTAAATATAATTAAACATAGACA
CAAGGAGACACAACAGCAAAAAGAACACGAAGAACAGAAAAAATAAACAA
ATTACGATGTGAGCAATTTCAAGTGTTTCAAGCCAAGTAAGAACTAATTA
ATAACATATGGAAAATCAACTGAAGACAGTGGTGACGCAAAGTGCACGTT
TTAAATGCAATAAAAAGGAAGGTAACAGAAAAACAAAAAATAAAATTAAT
TCAGATCACAACACTTACACACGGAGGAAAAAAAAAAAAA

FI03206.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
Caki.n 6418 Caki.n 89..4078 1..3990 19935 99.9 Plus
Caki.i 6269 Caki.i 89..4078 1..3990 19935 99.9 Plus
Caki.p 6459 Caki.p 76..2424 1..2349 11745 100 Plus
Caki.p 6459 Caki.p 2478..4119 2349..3990 8195 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17627441..17628933 1662..170 7405 99.7 Minus
chr3R 27901430 chr3R 17609512..17610612 3977..2877 5385 99.3 Minus
chr3R 27901430 chr3R 17615709..17615898 1848..1659 950 100 Minus
chr3R 27901430 chr3R 17610680..17610856 2876..2700 870 99.4 Minus
chr3R 27901430 chr3R 17615478..17615643 2012..1847 830 100 Minus
chr3R 27901430 chr3R 17613199..17613342 2349..2206 720 100 Minus
chr3R 27901430 chr3R 17611536..17611661 2592..2467 630 100 Minus
chr3R 27901430 chr3R 17611729..17611853 2473..2349 610 99.2 Minus
chr3R 27901430 chr3R 17631362..17631505 169..33 580 95.1 Minus
chr3R 27901430 chr3R 17610922..17611030 2701..2593 545 100 Minus
chr3R 27901430 chr3R 17613412..17613510 2210..2112 495 100 Minus
chr3R 27901430 chr3R 17615280..17615353 2081..2008 355 98.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
CASK-RD 1776 CG6703-PD 1..1776 1281..3056 8880 100 Plus
CASK-RA 1776 CG6703-PA 1..1776 1281..3056 8880 100 Plus
CASK-RE 1410 CG6703-PE 16..1410 1662..3056 6975 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:29 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
CASK-RD 4017 CG6703-RD 41..4017 1..3977 19885 100 Plus
CASK-RA 4112 CG6703-RA 168..4112 33..3977 19725 100 Plus
CASK-RG 4071 CG6703-RG 41..2389 1..2349 11745 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
CASK-PD 591 CG6703-PD 1..591 1281..3053 2733 100 Plus
CASK-PA 591 CG6703-PA 1..591 1281..3053 2733 100 Plus
CASK-PG 609 CG6703-PG 1..609 1281..3053 2704 97 Plus
CASK-PH 929 CG6703-PH 444..929 1659..3146 2484 97.8 Plus
CASK-PE 469 CG6703-PE 1..469 1644..3053 2385 99.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21803683..21805175 1662..170 7465 100 Minus
3R 32079331 3R 21785749..21786862 3990..2877 5555 99.9 Minus
3R 32079331 3R 21791960..21792149 1848..1659 950 100 Minus
3R 32079331 3R 21786930..21787106 2876..2700 885 100 Minus
3R 32079331 3R 21791729..21791894 2012..1847 830 100 Minus
3R 32079331 3R 21789449..21789592 2349..2206 720 100 Minus
3R 32079331 3R 21807599..21807735 169..33 685 100 Minus
3R 32079331 3R 21787786..21787911 2592..2467 630 100 Minus
3R 32079331 3R 21787979..21788103 2473..2349 610 99.2 Minus
3R 32079331 3R 21787172..21787280 2701..2593 545 100 Minus
3R 32079331 3R 21789662..21789760 2210..2112 495 100 Minus
3R 32079331 3R 21791531..21791604 2081..2008 355 98.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:27:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21544514..21546006 1662..170 7465 100 Minus
3R 31820162 3R 21526580..21527693 3990..2877 5555 99.9 Minus
3R 31820162 3R 21532791..21532980 1848..1659 950 100 Minus
3R 31820162 3R 21527761..21527937 2876..2700 885 100 Minus
3R 31820162 3R 21532560..21532725 2012..1847 830 100 Minus
3R 31820162 3R 21530280..21530423 2349..2206 720 100 Minus
3R 31820162 3R 21548430..21548566 169..33 685 100 Minus
3R 31820162 3R 21528617..21528742 2592..2467 630 100 Minus
3R 31820162 3R 21528810..21528934 2473..2349 610 99.2 Minus
3R 31820162 3R 21528003..21528111 2701..2593 545 100 Minus
3R 31820162 3R 21530493..21530591 2210..2112 495 100 Minus
3R 31820162 3R 21532362..21532435 2081..2008 355 98.6 Minus
3R 31820162 3R 21549448..21549480 33..1 165 100 Minus
3R 31820162 3R 21531540..21531571 2111..2080 160 100 Minus
Blast to na_te.dros performed 2014-11-27 14:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy10 6006 gypsy10 GYPSY10 6006bp 662..847 3634..3442 156 56.7 Minus
Stalker2 7672 Stalker2 STALKER2 7672bp 2024..2123 3524..3425 122 62.1 Minus

FI03206.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:01:37 Download gff for FI03206.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17632367..17632399 1..33 100   Minus
chr3R 17631362..17631504 34..169 95 <- Minus
chr3R 17627442..17628933 170..1661 96 <- Minus
chr3R 17615710..17615895 1662..1847 100 <- Minus
chr3R 17615478..17615642 1848..2012 100 <- Minus
chr3R 17615280..17615348 2013..2081 100 <- Minus
chr3R 17614459..17614488 2082..2111 100 <- Minus
chr3R 17613412..17613510 2112..2210 100 <- Minus
chr3R 17613199..17613337 2211..2349 100 <- Minus
chr3R 17611733..17611852 2350..2469 100 <- Minus
chr3R 17611536..17611658 2470..2592 100 <- Minus
chr3R 17610923..17611030 2593..2700 100 <- Minus
chr3R 17610680..17610855 2701..2876 99 <- Minus
chr3R 17609512..17610612 2877..3977 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:41:49 Download gff for FI03206.complete
Subject Subject Range Query Range Percent Splice Strand
Caki-RD 1..1776 1281..3056 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:13:01 Download gff for FI03206.complete
Subject Subject Range Query Range Percent Splice Strand
CASK-RD 1..1776 1281..3056 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:07:00 Download gff for FI03206.complete
Subject Subject Range Query Range Percent Splice Strand
CASK-RA 1..1776 1281..3056 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:01:37 Download gff for FI03206.complete
Subject Subject Range Query Range Percent Splice Strand
CASK-RA 1..1776 1281..3056 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:41:48 Download gff for FI03206.complete
Subject Subject Range Query Range Percent Splice Strand
Caki-RD 39..4015 1..3977 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:13:01 Download gff for FI03206.complete
Subject Subject Range Query Range Percent Splice Strand
CASK-RD 39..4015 1..3977 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:07:00 Download gff for FI03206.complete
Subject Subject Range Query Range Percent Splice Strand
CASK-RD 41..4017 1..3977 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-19 19:29:07 Download gff for FI03206.complete
Subject Subject Range Query Range Percent Splice Strand
Caki-RD 39..4015 1..3977 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:01:37 Download gff for FI03206.complete
Subject Subject Range Query Range Percent Splice Strand
CASK-RD 41..4017 1..3977 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:01:37 Download gff for FI03206.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21808617..21808649 1..33 100   Minus
3R 21807599..21807734 34..169 100 <- Minus
3R 21803684..21805175 170..1661 100 <- Minus
3R 21791961..21792146 1662..1847 100 <- Minus
3R 21791729..21791893 1848..2012 100 <- Minus
3R 21791531..21791599 2013..2081 100 <- Minus
3R 21790709..21790738 2082..2111 100 <- Minus
3R 21789662..21789760 2112..2210 100 <- Minus
3R 21789449..21789587 2211..2349 100 <- Minus
3R 21787983..21788102 2350..2469 100 <- Minus
3R 21787786..21787908 2470..2592 100 <- Minus
3R 21787173..21787280 2593..2700 100 <- Minus
3R 21786930..21787105 2701..2876 100 <- Minus
3R 21785762..21786862 2877..3977 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:07:00 Download gff for FI03206.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17634339..17634371 1..33 100   Minus
arm_3R 17633321..17633456 34..169 100 <- Minus
arm_3R 17629406..17630897 170..1661 100 <- Minus
arm_3R 17617683..17617868 1662..1847 100 <- Minus
arm_3R 17617451..17617615 1848..2012 100 <- Minus
arm_3R 17617253..17617321 2013..2081 100 <- Minus
arm_3R 17616431..17616460 2082..2111 100 <- Minus
arm_3R 17615384..17615482 2112..2210 100 <- Minus
arm_3R 17615171..17615309 2211..2349 100 <- Minus
arm_3R 17613705..17613824 2350..2469 100 <- Minus
arm_3R 17613508..17613630 2470..2592 100 <- Minus
arm_3R 17612895..17613002 2593..2700 100 <- Minus
arm_3R 17612652..17612827 2701..2876 100 <- Minus
arm_3R 17611484..17612584 2877..3977 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:43:35 Download gff for FI03206.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21549448..21549480 1..33 100   Minus
3R 21548430..21548565 34..169 100 <- Minus
3R 21544515..21546006 170..1661 100 <- Minus
3R 21532792..21532977 1662..1847 100 <- Minus
3R 21532560..21532724 1848..2012 100 <- Minus
3R 21532362..21532430 2013..2081 100 <- Minus
3R 21531540..21531569 2082..2111 100 <- Minus
3R 21530493..21530591 2112..2210 100 <- Minus
3R 21530280..21530418 2211..2349 100 <- Minus
3R 21528814..21528933 2350..2469 100 <- Minus
3R 21528617..21528739 2470..2592 100 <- Minus
3R 21528004..21528111 2593..2700 100 <- Minus
3R 21527761..21527936 2701..2876 100 <- Minus
3R 21526593..21527693 2877..3977 100 <- Minus

FI03206.pep Sequence

Translation from 1280 to 3055

> FI03206.pep
MCQHHGLTSQSLMSGGSHISLLGSSGSSGMSGSGVGSSGQSVPQCPAAVA
AADAAMMGSNAGGHCRSLSGLSSISIPPPPPALFNPCSSALSLQQAAVTR
WGPRTSCPVHSPFRVRVPNGSICSGHQALLHSHDVVARDVYGEEALRVTP
PPMVPYLNGDELDNVEGGELQHVTRVRLVQFQKNTDEPMGITLKMTEDGR
CIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGS
VTFKIVPSYRSAPPPCELFRIRPAPVLIFVRAQFDYNPLDDELIPCAQAG
ISFQVGDILQIISKDDHHWWQARLDTVGGSAGLIPSPELQEWRIACQTVD
KTKQEQVNCSIFGRKKKQCRDKYLAKHNAIFDTLDVVTYEEVVKVPVGDP
NFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENG
RSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAIL
DVEPQALKILRTAEFTPYVVFIAAPSLQNIADYDGSLERLAKESEMLRQL
YGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY*

FI03206.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 19:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16967-PA 1169 GF16967-PA 580..1169 1..591 2804 96.6 Plus
Dana\GF14547-PA 636 GF14547-PA 170..636 173..591 715 35.3 Plus
Dana\GF12435-PA 556 GF12435-PA 107..555 127..590 676 33.5 Plus
Dana\GF20363-PA 907 GF20363-PA 430..901 176..591 546 29.5 Plus
Dana\GF19077-PA 1005 GF19077-PA 787..1000 373..586 278 31.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 19:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22470-PA 315 GG22470-PA 1..315 277..591 1710 99.7 Plus
Dere\GG21549-PA 636 GG21549-PA 170..636 173..591 724 35.5 Plus
Dere\GG22696-PA 595 GG22696-PA 107..594 127..590 660 32.5 Plus
Dere\GG12561-PA 161 GG12561-PA 5..123 125..244 619 99.2 Plus
Dere\GG19306-PA 1299 GG19306-PA 949..1293 276..591 471 31.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 19:53:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18714-PA 596 GH18714-PA 1..596 1..591 2808 89.2 Plus
Dgri\GH10158-PA 636 GH10158-PA 168..636 173..591 707 35.8 Plus
Dgri\GH24103-PA 997 GH24103-PA 532..991 176..591 584 30.7 Plus
Dgri\GH12185-PA 828 GH12185-PA 350..823 171..586 382 27.3 Plus
Dgri\GH21953-PA 242 GH21953-PA 9..241 375..590 357 33.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
CASK-PD 591 CG6703-PD 1..591 1..591 3122 100 Plus
CASK-PA 591 CG6703-PA 1..591 1..591 3122 100 Plus
CASK-PG 609 CG6703-PG 1..609 1..591 3093 97 Plus
CASK-PE 469 CG6703-PE 1..469 122..591 2455 99.1 Plus
CASK-PH 929 CG6703-PH 444..898 127..591 2385 97.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 19:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22862-PA 594 GI22862-PA 1..594 1..591 2822 92.1 Plus
Dmoj\GI22442-PA 634 GI22442-PA 168..634 173..591 731 35.5 Plus
Dmoj\GI19661-PA 556 GI19661-PA 107..555 127..590 685 34.9 Plus
Dmoj\GI14373-PA 897 GI14373-PA 440..891 176..591 578 32 Plus
Dmoj\GI15716-PA 833 GI15716-PA 334..828 171..586 370 26.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 19:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23741-PA 487 GL23741-PA 23..487 127..591 2483 97.8 Plus
Dper\GL19590-PA 637 GL19590-PA 171..637 173..591 724 35.3 Plus
Dper\GL20641-PA 596 GL20641-PA 107..595 127..590 661 33 Plus
Dper\GL20368-PA 918 GL20368-PA 453..912 176..591 562 30 Plus
Dper\GL20800-PA 221 GL20800-PA 26..149 407..530 214 30.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 19:53:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19796-PA 1027 GA19796-PA 444..1027 1..591 2740 91.7 Plus
Dpse\GA21703-PA 637 GA21703-PA 171..637 173..591 726 35.3 Plus
Dpse\GA15582-PB 586 GA15582-PB 107..585 127..590 680 33.6 Plus
Dpse\GA15582-PA 596 GA15582-PA 107..595 127..590 661 33 Plus
Dpse\GA17100-PA 1002 GA17100-PA 538..996 176..591 581 30.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 19:53:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23693-PA 591 GM23693-PA 1..591 1..591 3177 99.5 Plus
Dsec\GM23306-PA 636 GM23306-PA 170..636 173..591 728 35.3 Plus
Dsec\GM20471-PA 593 GM20471-PA 105..592 127..590 659 32.5 Plus
Dsec\GM11239-PA 1309 GM11239-PA 959..1303 276..591 471 31.1 Plus
Dsec\GM25224-PA 234 GM25224-PA 39..162 407..530 218 32.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 19:53:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18503-PA 769 GD18503-PA 179..769 1..591 3164 99.5 Plus
Dsim\GD21680-PA 644 GD21680-PA 178..644 173..591 725 35.3 Plus
Dsim\GD25940-PA 377 GD25940-PA 1..376 207..590 628 34.7 Plus
Dsim\GD14257-PA 250 GD14257-PA 44..178 407..530 202 30.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 19:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14160-PA 1039 GJ14160-PA 443..1039 1..591 2825 90.7 Plus
Dvir\GJ20335-PA 634 GJ20335-PA 168..634 173..591 723 35.5 Plus
Dvir\GJ15026-PA 595 GJ15026-PA 107..594 127..590 669 33.8 Plus
Dvir\GJ19412-PA 1381 GJ19412-PA 923..1375 176..591 578 31.9 Plus
Dvir\GJ15244-PA 921 GJ15244-PA 703..916 373..586 272 31.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 19:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13019-PA 608 GK13019-PA 1..608 1..591 2840 91.4 Plus
Dwil\GK24864-PA 641 GK24864-PA 170..641 173..591 712 34.9 Plus
Dwil\GK20656-PA 599 GK20656-PA 107..598 127..590 672 33.2 Plus
Dwil\GK25185-PA 1626 GK25185-PA 1143..1620 149..591 575 30.5 Plus
Dwil\GK16229-PA 996 GK16229-PA 778..991 373..586 279 31.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 19:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24086-PA 594 GE24086-PA 1..594 1..591 2868 99 Plus
Dyak\GE13543-PA 636 GE13543-PA 170..636 173..591 716 35.1 Plus
Dyak\GE13049-PA 315 GE13049-PA 1..314 278..590 534 35.4 Plus
Dyak\GE15771-PA 1719 GE15771-PA 1370..1713 277..591 472 31.2 Plus
Dyak\GE15932-PA 902 GE15932-PA 684..897 373..586 278 31.7 Plus

FI03206.hyp Sequence

Translation from 1280 to 3055

> FI03206.hyp
MCQHHGLTSQSLMSGGSHISLLGSSGSSGMSGSGVGSSGQSVPQCPAAVA
AADAAMMGSNAGGHCRSLSGLSSISIPPPPPALFNPCSSALSLQQAAVTR
WGPRTSCPVHSPFRVRVPNGSICSGHQALLHSHDVVARDVYGEEALRVTP
PPMVPYLNGDELDNVEGGELQHVTRVRLVQFQKNTDEPMGITLKMTEDGR
CIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGS
VTFKIVPSYRSAPPPCELFRIRPAPVLIFVRAQFDYNPLDDELIPCAQAG
ISFQVGDILQIISKDDHHWWQARLDTVGGSAGLIPSPELQEWRIACQTVD
KTKQEQVNCSIFGRKKKQCRDKYLAKHNAIFDTLDVVTYEEVVKVPVGDP
NFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENG
RSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAIL
DVEPQALKILRTAEFTPYVVFIAAPSLQNIADYDGSLERLAKESEMLRQL
YGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLY*

FI03206.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
CASK-PD 591 CG6703-PD 1..591 1..591 3122 100 Plus
CASK-PA 591 CG6703-PA 1..591 1..591 3122 100 Plus
CASK-PG 609 CG6703-PG 1..609 1..591 3093 97 Plus
CASK-PE 469 CG6703-PE 1..469 122..591 2455 99.1 Plus
CASK-PH 929 CG6703-PH 444..898 127..591 2385 97.8 Plus