Clone FI03207 Report

Search the DGRC for FI03207

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:32
Well:7
Vector:pFlc-1
Associated Gene/TranscriptCG10073-RA
Protein status:FI03207.pep: gold
Sequenced Size:2769

Clone Sequence Records

FI03207.complete Sequence

2769 bp assembled on 2009-04-22

GenBank Submission: BT082055.1

> FI03207.complete
TGGAGTCAGTTTGATTTTAAGCAAAGCAGTAACTTGAGTTGTTTAAGTTG
ATCGATAAAATGGGTGACAAAGACAAACTGATTTCTGATGAGCCAATCGA
AGATGCCGTTAGATCGGCATCCTCTAAAAAAATCAAAAACCAGGAACAAT
ACTTACGAGGACCCTGGTATTTGGCCACTGGTTTTCTACTGTTTTGGGCA
CTCCTCTTCTCGGCCGTGGTATTACCACTCTTTTACCGCATTCCCACAGG
ATTGACCATTGAGGATGCATCCAAGGGCGTCTTTATCGCCGAACGAGCCC
AAAGCAATCTTTACAAATTAGCCGAAATCGGTACCAAAGTCGTTGGCAGT
GATAACAATGAGAACAAAACTGTTGACTATCTGATGGGTCTAGTGAACGA
GATACAGGAGAATTGCCTGGATGACTACTTCGACATCGAAGTCGATTTGC
AAGAGGTCTCGGGATCCTATATTCATTGGACCATGGTCAATATGTACCAG
GGCGTTCAGAATATTGTGATCAAACTGAGTCCCAAGAATACCACGAGTAC
CACTTACCTGCTCGTCAACAGTCACTTCGATTCCAAGCCGACTAGTCCAT
CTGCTGGCGATGCTGGTCAGATGGTTGTTGCCATCCTGGAGGTCCTGCGA
GTGATGTGCTCAACCAAGCAAGCCATTAGGCATCCAGTCGTCTTTCTACT
GAACGGAGCCGAGGAGAATCCACTACAAGCTTCGCATGGCTTCATTACCC
AACACAAATGGGCTAAAAACTGCAAGGTGGTTCTCAATTTGGATGCAGCT
GGCAATGGCGGTAGTGATATAGTGTTCCAAACTGGACCTAATAGCCCTTG
GCTTGTAGAAAAATACAAAGAAAATGCACCACACTATCTGGCTACCACAA
TGGCTGAGGAAATCTTCCAAACAGGCATCCTGCCCTCCGACACTGATTTT
GCTATCTTTGTCAAGTATGGTAATCTTATTGGTTTGGACATGGCCAAGTT
TATCAATGGTTTCGCCTATCACACCAAGTACGATCAATTCTCCAATATTC
CCAGAGGATCCATACAAAATACGGGCGATAATTTGCTTGGTCTGGTGCGA
TCCATAGCCAATTCTACGGAACTGGATAACACAGAGGCTTATGCCACAGG
ACATGCCATCTTTTTCGATGTCCTGGGACTGTACTTCATTAGCTATACGG
AGAGCAATGGCGTTATTCTCAATTATTCCGTGGCCGGAGTGGCACTTGTC
CTGATTTTCTTATCCATTTGGCGTACATCAAGCATATCCCGTGTGTCCAT
AGGACACGTTCTCTGCTGGTTCATTTTGATCTTTGTGCTGCAGATCATAG
CTTTTGTACTGGGACTCGGACTGCCCATAGTCGTAGCCTATGTTTTCGAT
AAGTACGGACTATCCATCACTTACTTCAGCACTCCAGTCCTGCTAATTGG
CCTCTATATTTGCCCGAGTCTATTGGGATTGAGCTTGCCATCCTACATCT
ACCTGAAGTTGCAACGAAGTGAAAAGGTCGGATTCGCCCAACATCTGCAG
CTGGTTCTCCATGGACACGCTGCAGTGCTGGCTATCTTGGACATTGGATT
GACCGTTTATGGACTGCGTAGCGCCTATGTGCCCACCTGGACACTCATCT
TCTACGTCATTCCCTTGGCCGTCAATCTGTTGACCACTTTGCATGATCGC
GGCTTTTCCTGGACCGGTGTGCTCAAGATATTCCAAGTAGTTCCCTTCCT
TTACAATAGCTATTTGATTTACTGTTTCGTGGTGACTCTCATACCCATGA
TGGGTCGTTTTGGCCGAGCAACTAATCCGGATTTGATTATATCGGCTTTG
TGTGCTTTGGGAACCATTTTGGCTTTGGGTTTCGTGATACCCCTAGTTAA
CATGTTCCGACGCCCCAGTCTGATCCTGCTCACCTTGTTGGCCATAAGCG
CTGTGACCATTTACACGGCTAGCTCCACCCAAATTGGTTTTCCATACCGT
CCAAAGACCAACGTTCAGCGACTTCCCTACCTGCATGTACGACGAATCTT
CTACGAATACGATGGCACAGTTGTGAAGAATGACTCCGGCTATCTGTTCA
ACTTCCAGGATCGTCGGGGACCAGCACCCCTGAAACTGTCCAAGTTGAAT
ACGACTGGATTGGTCAGCATTGCTGCGGACTGTGATACGGTTATGATGTG
CGGATTTCCTCTATATGATCACCGATGGGTTAAGAATCGTCTGCAGATAA
TGTGGCTGCCAAGAGAAGAGGAAATCATTACGCCATATGAGCCGAAACTT
GAGCTATTGTCCAAAACGGAACTGGGAAACAATACACTGCGCATGAATTT
CCAATCAGCGACTACGGATCATGCCAGTGTGTTTATCCAGCCACTTGAAG
ATGTTATCATTTCCAACTGGAGCCTGCCCACGAGTTACATTGGCCAGCAG
GATACCTCCCATATGTACTTCTCATATGGCAAGAACAACACGGCATTGAC
TTTCTTTATTGACTTTTATAAACTGGATGCCGACTTTGCCGTACCCTTGT
GTCAGATCGGATTGGCTGTCCATTTTATTGGCAACAAAGGCGATGCAATC
AGTCAGGAGTTTGCCAAGAAGATACCATCATTTGCCGCTGCAGTGGATTG
GCCAGCTTCCTACCAACGTTACATTTTCTAAGGACTTCGATCTCGATCGC
GAAAATAATTATTTTAAACACAAGTCGAACAATAAAATGAACTGCTAAAC
ATTGAAAAAAAAAAAAAAA

FI03207.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:22:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG10073-RA 2765 CG10073-RA 5..2757 4..2756 13765 100 Plus
CG10073.a 2779 CG10073.a 71..2747 80..2756 13385 100 Plus
CG10081.a 2741 CG10081.a 691..832 702..843 260 78.8 Plus
CG10081.a 2741 CG10081.a 883..1024 894..1035 260 78.8 Plus
CG10081.a 2741 CG10081.a 1633..1796 1650..1813 250 76.8 Plus
CG10081.a 2741 CG10081.a 1954..2054 1971..2071 205 80.1 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15268933..15269629 80..776 3290 98.1 Plus
chr2R 21145070 chr2R 15271360..15271846 2033..2519 2420 99.8 Plus
chr2R 21145070 chr2R 15270222..15270608 1135..1521 1920 99.7 Plus
chr2R 21145070 chr2R 15270667..15270962 1521..1816 1465 99.7 Plus
chr2R 21145070 chr2R 15271909..15272143 2520..2754 1100 97.9 Plus
chr2R 21145070 chr2R 15270017..15270173 981..1137 785 100 Plus
chr2R 21145070 chr2R 15271156..15271303 1886..2033 725 99.3 Plus
chr2R 21145070 chr2R 15269832..15269954 861..983 600 99.2 Plus
chr2R 21145070 chr2R 15269689..15269773 776..860 425 100 Plus
chr2R 21145070 chr2R 15268798..15268874 4..80 385 100 Plus
chr2R 21145070 chr2R 15271012..15271090 1808..1886 365 97.5 Plus
chr2R 21145070 chr2R 15275025..15275302 1536..1813 310 74.1 Plus
chr2R 21145070 chr2R 15246675..15246984 467..776 275 72.6 Plus
chr2R 21145070 chr2R 15264771..15264857 690..776 240 85.1 Plus
chr2R 21145070 chr2R 8247492..8247588 680..776 215 81.4 Plus
chr2R 21145070 chr2R 8243702..8243789 676..763 185 80.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG10073-RA 2622 CG10073-PA 1..2622 60..2681 13110 100 Plus
CG10073-RC 2646 CG10073-PC 45..2646 80..2681 13010 100 Plus
CG10081-RB 2622 CG10081-PB 425..976 484..1035 480 72.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:30 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG10073-RA 2751 CG10073-RA 1..2751 4..2754 13755 100 Plus
CG10073-RC 2747 CG10073-RC 73..2747 80..2754 13375 100 Plus
CG10081-RB 2732 CG10081-RB 470..1021 484..1035 480 72.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG10073-PA 873 CG10073-PA 1..873 60..2678 4459 100 Plus
CG10073-PC 881 CG10073-PC 16..881 81..2678 4422 100 Plus
CG10081-PA 875 CG10081-PA 1..875 60..2678 2838 61.7 Plus
CG10081-PB 873 CG10081-PB 1..873 60..2678 2815 61.5 Plus
CG30047-PA 879 CG30047-PA 31..879 156..2678 2175 49.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19381755..19382451 80..776 3485 100 Plus
2R 25286936 2R 19384182..19384668 2033..2519 2435 100 Plus
2R 25286936 2R 19383044..19383430 1135..1521 1935 100 Plus
2R 25286936 2R 19383489..19383784 1521..1816 1480 100 Plus
2R 25286936 2R 19384731..19384967 2520..2756 1185 100 Plus
2R 25286936 2R 19382839..19382995 981..1137 785 100 Plus
2R 25286936 2R 19383978..19384125 1886..2033 740 100 Plus
2R 25286936 2R 19382654..19382776 861..983 615 100 Plus
2R 25286936 2R 19382511..19382595 776..860 425 100 Plus
2R 25286936 2R 19381620..19381696 4..80 385 100 Plus
2R 25286936 2R 19383834..19383912 1808..1886 365 97.5 Plus
2R 25286936 2R 19387854..19388131 1536..1813 280 73.4 Plus
2R 25286936 2R 19359536..19359845 467..776 260 72.3 Plus
2R 25286936 2R 19377602..19377688 690..776 240 85.1 Plus
2R 25286936 2R 12360234..12360330 680..776 215 81.4 Plus
2R 25286936 2R 12356445..12356532 676..763 185 80.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19382954..19383650 80..776 3485 100 Plus
2R 25260384 2R 19385381..19385867 2033..2519 2435 100 Plus
2R 25260384 2R 19384243..19384629 1135..1521 1935 100 Plus
2R 25260384 2R 19384688..19384983 1521..1816 1480 100 Plus
2R 25260384 2R 19385930..19386166 2520..2756 1185 100 Plus
2R 25260384 2R 19384038..19384194 981..1137 785 100 Plus
2R 25260384 2R 19385177..19385324 1886..2033 740 100 Plus
2R 25260384 2R 19383853..19383975 861..983 615 100 Plus
2R 25260384 2R 19383710..19383794 776..860 425 100 Plus
2R 25260384 2R 19382819..19382895 4..80 385 100 Plus
2R 25260384 2R 19385033..19385111 1808..1886 365 97.4 Plus
2R 25260384 2R 19389167..19389330 1650..1813 250 76.8 Plus
2R 25260384 2R 19360735..19360852 467..584 245 80.5 Plus
2R 25260384 2R 19378801..19378887 690..776 240 85 Plus
2R 25260384 2R 12361433..12361529 680..776 215 81.4 Plus
2R 25260384 2R 19387910..19387984 702..776 150 80 Plus
2R 25260384 2R 19388231..19388320 894..983 150 77.7 Plus
Blast to na_te.dros performed on 2014-11-27 16:10:15 has no hits.

FI03207.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:13:10 Download gff for FI03207.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15271909..15272143 2520..2754 97   Plus
chr2R 15271361..15271846 2034..2519 99 -> Plus
chr2R 15271157..15271303 1887..2033 99 -> Plus
chr2R 15271021..15271090 1817..1886 100 -> Plus
chr2R 15270667..15270962 1521..1816 99 -> Plus
chr2R 15270224..15270607 1137..1520 99 -> Plus
chr2R 15270018..15270172 982..1136 100 -> Plus
chr2R 15269832..15269952 861..981 99 -> Plus
chr2R 15269689..15269773 776..860 100 -> Plus
chr2R 15268934..15269628 81..775 98 -> Plus
chr2R 15268794..15268874 1..80 96 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:50:58 Download gff for FI03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG10073-RA 1..2622 60..2681 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:46:02 Download gff for FI03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG10073-RA 1..2622 60..2681 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:31:04 Download gff for FI03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG10073-RA 1..2622 60..2681 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:13:10 Download gff for FI03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG10073-RA 1..2622 60..2681 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-22 17:22:39 Download gff for FI03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG10073-RA 2..2755 3..2754 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:46:02 Download gff for FI03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG10073-RA 2..2755 3..2754 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:31:04 Download gff for FI03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG10073-RA 1..2751 4..2754 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:13:10 Download gff for FI03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG10073-RA 1..2751 4..2754 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:13:10 Download gff for FI03207.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19384731..19384965 2520..2754 100   Plus
2R 19384183..19384668 2034..2519 100 -> Plus
2R 19383979..19384125 1887..2033 100 -> Plus
2R 19383843..19383912 1817..1886 100 -> Plus
2R 19383489..19383784 1521..1816 100 -> Plus
2R 19383046..19383429 1137..1520 100 -> Plus
2R 19382840..19382994 982..1136 100 -> Plus
2R 19382654..19382774 861..981 100 -> Plus
2R 19382511..19382595 776..860 100 -> Plus
2R 19381756..19382450 81..775 100 -> Plus
2R 19381616..19381696 1..80 96 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:31:04 Download gff for FI03207.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15272236..15272470 2520..2754 100   Plus
arm_2R 15271688..15272173 2034..2519 100 -> Plus
arm_2R 15271484..15271630 1887..2033 100 -> Plus
arm_2R 15271348..15271417 1817..1886 100 -> Plus
arm_2R 15270994..15271289 1521..1816 100 -> Plus
arm_2R 15270551..15270934 1137..1520 100 -> Plus
arm_2R 15270345..15270499 982..1136 100 -> Plus
arm_2R 15270159..15270279 861..981 100 -> Plus
arm_2R 15270016..15270100 776..860 100 -> Plus
arm_2R 15269261..15269955 81..775 100 -> Plus
arm_2R 15269121..15269201 1..80 96 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:31:49 Download gff for FI03207.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19385930..19386164 2520..2754 100   Plus
2R 19385382..19385867 2034..2519 100 -> Plus
2R 19385178..19385324 1887..2033 100 -> Plus
2R 19385042..19385111 1817..1886 100 -> Plus
2R 19384688..19384983 1521..1816 100 -> Plus
2R 19384245..19384628 1137..1520 100 -> Plus
2R 19384039..19384193 982..1136 100 -> Plus
2R 19383853..19383973 861..981 100 -> Plus
2R 19383710..19383794 776..860 100 -> Plus
2R 19382955..19383649 81..775 100 -> Plus
2R 19382815..19382895 1..80 96 -> Plus

FI03207.pep Sequence

Translation from 59 to 2680

> FI03207.pep
MGDKDKLISDEPIEDAVRSASSKKIKNQEQYLRGPWYLATGFLLFWALLF
SAVVLPLFYRIPTGLTIEDASKGVFIAERAQSNLYKLAEIGTKVVGSDNN
ENKTVDYLMGLVNEIQENCLDDYFDIEVDLQEVSGSYIHWTMVNMYQGVQ
NIVIKLSPKNTTSTTYLLVNSHFDSKPTSPSAGDAGQMVVAILEVLRVMC
STKQAIRHPVVFLLNGAEENPLQASHGFITQHKWAKNCKVVLNLDAAGNG
GSDIVFQTGPNSPWLVEKYKENAPHYLATTMAEEIFQTGILPSDTDFAIF
VKYGNLIGLDMAKFINGFAYHTKYDQFSNIPRGSIQNTGDNLLGLVRSIA
NSTELDNTEAYATGHAIFFDVLGLYFISYTESNGVILNYSVAGVALVLIF
LSIWRTSSISRVSIGHVLCWFILIFVLQIIAFVLGLGLPIVVAYVFDKYG
LSITYFSTPVLLIGLYICPSLLGLSLPSYIYLKLQRSEKVGFAQHLQLVL
HGHAAVLAILDIGLTVYGLRSAYVPTWTLIFYVIPLAVNLLTTLHDRGFS
WTGVLKIFQVVPFLYNSYLIYCFVVTLIPMMGRFGRATNPDLIISALCAL
GTILALGFVIPLVNMFRRPSLILLTLLAISAVTIYTASSTQIGFPYRPKT
NVQRLPYLHVRRIFYEYDGTVVKNDSGYLFNFQDRRGPAPLKLSKLNTTG
LVSIAADCDTVMMCGFPLYDHRWVKNRLQIMWLPREEEIITPYEPKLELL
SKTELGNNTLRMNFQSATTDHASVFIQPLEDVIISNWSLPTSYIGQQDTS
HMYFSYGKNNTALTFFIDFYKLDADFAVPLCQIGLAVHFIGNKGDAISQE
FAKKIPSFAAAVDWPASYQRYIF*

FI03207.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12334-PA 882 GF12334-PA 16..882 8..873 3262 69.3 Plus
Dana\GF12336-PA 870 GF12336-PA 1..870 1..873 3080 64.9 Plus
Dana\GF12337-PA 876 GF12337-PA 1..876 1..873 2766 58.1 Plus
Dana\GF12338-PA 870 GF12338-PA 1..870 1..873 2290 50.9 Plus
Dana\GF12845-PA 879 GF12845-PA 23..879 20..873 2165 48.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21966-PA 873 GG21966-PA 1..873 1..873 4223 89.2 Plus
Dere\GG21967-PA 875 GG21967-PA 1..875 1..873 2857 61.1 Plus
Dere\GG20280-PA 875 GG20280-PA 20..875 26..873 2123 48.2 Plus
Dere\GG20282-PA 878 GG20282-PA 2..878 4..873 2021 46.1 Plus
Dere\GG20284-PA 875 GG20284-PA 33..874 36..872 2006 46 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20685-PA 871 GH20685-PA 1..871 1..873 2615 56.1 Plus
Dgri\GH20688-PA 859 GH20688-PA 3..859 27..873 2267 49.2 Plus
Dgri\GH20689-PA 879 GH20689-PA 6..879 3..873 2128 45.2 Plus
Dgri\GH20684-PA 655 GH20684-PA 1..604 1..611 1964 58.4 Plus
Dgri\GH20686-PA 617 GH20686-PA 17..617 277..873 1771 55.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG10073-PA 873 CG10073-PA 1..873 1..873 4531 100 Plus
CG10073-PC 881 CG10073-PC 16..881 8..873 4494 100 Plus
CG10081-PA 875 CG10081-PA 1..875 1..873 2877 61.7 Plus
CG10081-PB 873 CG10081-PB 1..873 1..873 2854 61.5 Plus
CG30047-PA 879 CG30047-PA 31..879 33..873 2201 49.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19047-PA 867 GI19047-PA 1..867 1..873 2639 56.4 Plus
Dmoj\GI19049-PA 872 GI19049-PA 1..872 1..873 2596 56.2 Plus
Dmoj\GI18384-PA 875 GI18384-PA 1..875 1..873 2413 53.8 Plus
Dmoj\GI18383-PA 872 GI18383-PA 1..872 1..873 2382 52.4 Plus
Dmoj\GI19046-PA 2292 GI19046-PA 745..1565 5..829 2374 53.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11619-PA 872 GL11619-PA 1..872 1..873 3415 72 Plus
Dper\GL11620-PA 1429 GL11620-PA 563..1429 5..873 3079 66.6 Plus
Dper\GL11621-PA 876 GL11621-PA 1..876 1..873 2965 64.5 Plus
Dper\GL11623-PA 881 GL11623-PA 22..881 24..873 2300 49.5 Plus
Dper\GL11625-PA 879 GL11625-PA 2..879 4..873 2161 46.5 Plus
Dper\GL11620-PA 1429 GL11620-PA 9..568 269..823 1917 63.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:05:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10051-PA 872 GA10051-PA 1..872 1..873 3412 71.9 Plus
Dpse\GA10058-PA 871 GA10058-PA 1..871 1..873 3099 67 Plus
Dpse\GA24796-PA 876 GA24796-PA 1..876 1..873 2913 64.4 Plus
Dpse\GA15604-PA 881 GA15604-PA 22..881 24..873 2300 49.8 Plus
Dpse\GA15600-PA 879 GA15600-PA 30..879 33..873 2158 47.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21954-PA 873 GM21954-PA 1..873 1..873 4450 95.3 Plus
Dsec\GM21365-PA 878 GM21365-PA 23..878 21..873 2149 48 Plus
Dsec\GM21368-PA 878 GM21368-PA 2..877 4..872 2018 46.9 Plus
Dsec\GM21371-PA 856 GM21371-PA 15..856 14..873 1955 45.3 Plus
Dsec\GM21370-PA 927 GM21370-PA 65..927 36..873 1905 43.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11450-PA 873 GD11450-PA 1..873 1..873 4449 95.2 Plus
Dsim\GD11451-PA 875 GD11451-PA 1..875 1..873 2855 62.2 Plus
Dsim\GD10862-PA 879 GD10862-PA 23..879 21..873 2167 48.3 Plus
Dsim\GD10864-PA 878 GD10864-PA 2..878 4..873 2051 46.6 Plus
Dsim\GD10867-PA 909 GD10867-PA 39..909 14..873 2047 45 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20015-PA 1217 GJ20015-PA 358..1217 9..873 2689 59 Plus
Dvir\GJ20017-PA 877 GJ20017-PA 16..877 8..873 2614 57.4 Plus
Dvir\GJ21461-PA 872 GJ21461-PA 1..872 1..873 2550 57.2 Plus
Dvir\GJ21460-PA 864 GJ21460-PA 3..864 14..873 2408 56.6 Plus
Dvir\GJ20019-PA 879 GJ20019-PA 1..878 1..872 2251 49 Plus
Dvir\GJ20015-PA 1217 GJ20015-PA 1..353 1..359 1116 59.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20845-PA 877 GK20845-PA 1..877 1..873 3224 69 Plus
Dwil\GK20847-PA 877 GK20847-PA 1..877 1..873 2826 62 Plus
Dwil\GK20846-PA 877 GK20846-PA 1..877 1..873 2810 61.4 Plus
Dwil\GK23251-PA 904 GK23251-PA 60..904 33..873 2108 47.9 Plus
Dwil\GK23157-PA 883 GK23157-PA 26..883 26..873 1992 44.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12045-PA 873 GE12045-PA 1..873 1..873 4141 87.6 Plus
Dyak\GE12046-PA 875 GE12046-PA 1..875 1..873 2884 61.7 Plus
Dyak\GE12439-PA 878 GE12439-PA 22..878 25..873 2141 48.1 Plus
Dyak\GE12441-PA 878 GE12441-PA 2..878 4..873 2080 46.1 Plus
Dyak\GE12444-PA 875 GE12444-PA 33..875 36..873 2037 46.5 Plus

FI03207.hyp Sequence

Translation from 59 to 2680

> FI03207.hyp
MGDKDKLISDEPIEDAVRSASSKKIKNQEQYLRGPWYLATGFLLFWALLF
SAVVLPLFYRIPTGLTIEDASKGVFIAERAQSNLYKLAEIGTKVVGSDNN
ENKTVDYLMGLVNEIQENCLDDYFDIEVDLQEVSGSYIHWTMVNMYQGVQ
NIVIKLSPKNTTSTTYLLVNSHFDSKPTSPSAGDAGQMVVAILEVLRVMC
STKQAIRHPVVFLLNGAEENPLQASHGFITQHKWAKNCKVVLNLDAAGNG
GSDIVFQTGPNSPWLVEKYKENAPHYLATTMAEEIFQTGILPSDTDFAIF
VKYGNLIGLDMAKFINGFAYHTKYDQFSNIPRGSIQNTGDNLLGLVRSIA
NSTELDNTEAYATGHAIFFDVLGLYFISYTESNGVILNYSVAGVALVLIF
LSIWRTSSISRVSIGHVLCWFILIFVLQIIAFVLGLGLPIVVAYVFDKYG
LSITYFSTPVLLIGLYICPSLLGLSLPSYIYLKLQRSEKVGFAQHLQLVL
HGHAAVLAILDIGLTVYGLRSAYVPTWTLIFYVIPLAVNLLTTLHDRGFS
WTGVLKIFQVVPFLYNSYLIYCFVVTLIPMMGRFGRATNPDLIISALCAL
GTILALGFVIPLVNMFRRPSLILLTLLAISAVTIYTASSTQIGFPYRPKT
NVQRLPYLHVRRIFYEYDGTVVKNDSGYLFNFQDRRGPAPLKLSKLNTTG
LVSIAADCDTVMMCGFPLYDHRWVKNRLQIMWLPREEEIITPYEPKLELL
SKTELGNNTLRMNFQSATTDHASVFIQPLEDVIISNWSLPTSYIGQQDTS
HMYFSYGKNNTALTFFIDFYKLDADFAVPLCQIGLAVHFIGNKGDAISQE
FAKKIPSFAAAVDWPASYQRYIF*

FI03207.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG10073-PA 873 CG10073-PA 1..873 1..873 4531 100 Plus
CG10073-PC 881 CG10073-PC 16..881 8..873 4494 100 Plus
CG10081-PA 875 CG10081-PA 1..875 1..873 2877 61.7 Plus
CG10081-PB 873 CG10081-PB 1..873 1..873 2854 61.5 Plus
CG30047-PA 879 CG30047-PA 31..879 33..873 2201 49.2 Plus