Clone FI03221 Report

Search the DGRC for FI03221

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:32
Well:21
Vector:pFlc-1
Associated Gene/TranscriptCG9977-RA
Protein status:FI03221.pep: gold
Sequenced Size:3033

Clone Sequence Records

FI03221.complete Sequence

3033 bp assembled on 2009-01-14

GenBank Submission: BT057981.1

> FI03221.complete
ATTTTCGCGTGTCTCGCTTACTGTCCTCGGTTCGGTTTAGTTCTCTTTTC
TCCGGATAAAATCAAATTCAATAAGCGATCGCCAAACGATCCCCCACTTG
GTCGCCACACAAACAACGTCGCCCGAAAGCCGACGGCTGCATCATCATCC
CCTCTCCGGAAACTCCCATCAAGCCCCGGATCCAAAGTGTAGCCCCCCAT
TCGCAAAAGAAGAAGAAGAACAAAAACAATAGTGGAGAGGTGAAACAAAG
GAGACTCGCACTAAAAACAATTAATTTAGCAATTTGTGGTCTCCACAACG
TCGATAAATCACGTGATTGTGCAGTTCGTATAGACCCAGGCCACACCACT
AGCCATTTGCAGCGCATCCTGCTTGGATTTCAGACTTTACATAACATCCA
AGGCGCCCATTCAAAGGAGCAGCGGAAAAGGATTGCAAGCTCTGGAGTCG
CAGAAGGTGGAACACTAGGAGCTAGAGCAAGGAGCCAATTTAAGGGATAG
TAAGGAAATCCCCAGATTACCCTCTACTTCCACCATGAACAACCTGGCAG
ACACTGTGGTAGTTGATCCTGGATTCGGAGGCGGCGACAAGCAGCAGCAG
GCTGGACCGGCGCCGCAGGATGCCAGCGTGGTGGTTCCTCCGCCGGCCAC
CAAGCAGTCCTCGGCTCTGAAGAAGACAAGTCGGTACAGGAGCCGCTCGC
TTAGTGCCTCCTCAACGGATTCCTTCAGCTCCGCCAGCTACACGGGCAGC
AGCGAGGATGGCGACGACGTGCCGCCCAGGGAGAAGGTCCAAAAGAACTC
CAAAGGCAGCTCCGATTTCTGTGTAAGGAACATAGGCGCCCAGCATGCAT
TTGGGCGCAGGGAGATCGAGATTGCGGAGCAGGAGATGCCGGGCATCATA
GCGCTGAAGAAGCGGGCGGCCGAGGACAAGCCTCTGAAGGATGCCAAGAT
CGTGGGTTGCACACACATCAACGCCCAGACTGCCGTGCTCATCGAGACGC
TGGTGGAACTGGGCGCCAGCGTGCGCTGGGCCGCCTGCAACATCTACTCC
ACGCAGAACGAAGTGGCTGCTGCTTTGGCCGAATCCGGAATCCCGATCTT
TGCCTGGCGCGGCGAGACGGAAGAGGACTTCTGGTGGTGCATAGATCGCT
GCGTTAACGCCGAGAACTGGCAGCCAAACATGATCCTGGACGATGGCGGC
GATGCCACGCACTTGATGCTAAAAAAGTACCCGACCATGTTCAAGTTGGT
CAAGGGAATCGTCGAGGAGAGCGTCACCGGAGTGCACCGTCTCTATCAGC
TCTCTAAGGCCGGCAAGCTGACAGTGCCGGCGATGAATGTCAACGATTCG
GTGACAAAGACCAAATTTGACAACCTCTACAGCTGCAAGGAATCCATCCT
GGACAGCCTCAAGCGCTCCACGGACGTGATGTTCGGTGGCAAGCAGGTCG
TGGTCTGTGGCTACGGCGATGTGGGCAAGGGATGTGCCCAGGCTCTAAAG
GGGCAGGGCTGCATTGTGTACATCACAGAGATCGATCCCATTTGCGCCCT
GCAGGCCAGTATGGATGGCTTCCGTGTGGTCAAGCTGAACGAGGTGATCC
GCAACGTAGACATTGTGGTGACGGCGACCGGCAACAAGAACGTGGTGGTG
CGCGAGCACATGGACAAGATGAAGAGTGGCTGCATCGTATGCAACATGGG
CCACTCGAACACGGAAATCGATGTGAATGGCCTGCGCACACCGGACTTGA
CCTGGGAGAAGGTGCGCTCCCAGGTGGATCACATTATCTGGCCGGAGGGC
AAGTACATCATTCTTCTGGCCGAGGGCAGGCTGGTCAATCTGAGCTGCTC
CAGCATCCCCTCGTTCGCCGTGTCTATCACCTCGGCCACCCAGGCCCTGG
CCCTGATCGAGCTTTTCAATGCCCCGCCCGGACGCTACAAGTCGGATGTC
TACTTGCTGCCCAAGAAGATGGACGAGTATGTTGCCAGCCTGCACCTGCC
CACCTTCGATGCCCATTTGACGGAGCTGAGCGACGAGCAGGCCAAGTACA
TGGGACTGAACAAGGCCGGTCCTTTCAAGCCCAACTACTACCGCTACTAG
GACGCAAGGCGGGCGGATGCGGACAATAACACCAGCAATTAGAAGAAACA
ACAACGCCAACGAAAGTATTGTCTTTGCGAAGAAGTAAAACTATTTAAAA
CAATTGTTGACACACACACACACGGAAAACACAAAAGGATACGGAAAGGA
GAACACAAAGTTACTATTACCATTGTATTGCTTAGTTTAGCTCGAGCGGA
ATTCTTGGTTGCTTTTCGTTAGCATTTAAAGTCTTCGACATAGTATTTAG
CACTCGCTTTAGCCGCAGGAGTATTCTCTCCGTTCACCTATCCAACATGA
CTCTCTAATCCCCAAAACTAATCTTGCCCCAAGAATTTATCCCCATCAAC
ATTTTTTGTAGCCAGTTACTTGAATTTATTTTAAATACTTCGAACGCCTG
TCAATCAGACTGCAGTAGCTCAAAAGACGCGATTAGTTCTCTAAATGTAT
ACTTCTAATTCGGAATTGATAATATATTTTATGGGAATTGACTTGTATAA
TGGTTTCTAGCATATTTGCATTACATTTCTATAACTTTTTCGCGTGAAAT
CCATGTACATTTTAATGTTAACGACTTTCCTGACTAATCCCTTTTTTGAG
CTACGACAGCTGGGCAATAAGTGATCGATTTAACCTCTCGTATTGTTTAC
GTACTTAATTTGTTAATGTTTATGGCCCCCGCTTATGATTATGATTATAC
TTTTGTACTTTCGTTTCGTCCCGAGAGCGTTAATGGAACAGCAGTGCAAG
GTATTCCATTTATTCAATTATATACACGCTGGCATATATATCAGATCGAG
AATTATATATATATATACACTGCATATACACCTAATATGTATATTAGAAA
AAGTGAAAAATGTTTGTAAGAAATTTGTGAGAAACGCAAAACAATAAAAA
AGGGATTCTTTATTGAGCAAAAAAAAAAAAAAA

FI03221.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG9977-RA 3082 CG9977-RA 38..3057 1..3020 15070 99.9 Plus
Ahcy89E-RD 2020 Ahcy89E-RD 615..909 846..1140 575 79.6 Plus
Ahcy89E-RC 2058 Ahcy89E-RC 690..984 846..1140 575 79.6 Plus
Ahcy89E-RD 2020 Ahcy89E-RD 1162..1406 1393..1637 355 76.3 Plus
Ahcy89E-RC 2058 Ahcy89E-RC 1237..1481 1393..1637 355 76.3 Plus
Ahcy89E-RD 2020 Ahcy89E-RD 1691..1857 1925..2091 325 79.6 Plus
Ahcy89E-RC 2058 Ahcy89E-RC 1766..1932 1925..2091 325 79.6 Plus
Ahcy89E-RD 2020 Ahcy89E-RD 1438..1686 1669..1917 255 73.4 Plus
Ahcy89E-RC 2058 Ahcy89E-RC 1513..1761 1669..1917 255 73.4 Plus
Ahcy89E-RD 2020 Ahcy89E-RD 936..1001 1167..1232 210 87.8 Plus
Ahcy89E-RC 2058 Ahcy89E-RC 1011..1076 1167..1232 210 87.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2767903..2769416 3018..1505 7540 99.9 Minus
chr3L 24539361 chr3L 2770705..2771760 1056..1 5280 100 Minus
chr3L 24539361 chr3L 2769478..2769930 1507..1055 2250 99.8 Minus
chr3R 27901430 chr3R 12803953..12804513 1406..846 780 75.9 Minus
chr3R 27901430 chr3R 12803256..12803500 1972..1725 230 73.8 Minus
chr3R 27901430 chr3R 12803068..12803175 2091..1984 195 78.7 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG9977-RA 1566 CG9977-PA 1..1566 535..2100 7815 99.9 Plus
Ahcy89E-RD 1515 CG8956-PD 228..1470 846..2091 1485 74.8 Plus
Ahcy89E-RC 1479 CG8956-PC 228..1470 846..2091 1485 74.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:34 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG9977-RA 3020 CG9977-RA 3..3020 1..3018 15060 99.9 Plus
Ahcy89E-RD 1969 CG8956-RD 574..1816 846..2091 1485 74.8 Plus
Ahcy89E-RC 1780 CG8956-RC 451..1693 846..2091 1485 74.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG9977-PA 521 CG9977-PA 1..516 535..2082 2536 100 Plus
Ahcy89E-PC 492 CG8956-PC 48..486 757..2079 1899 78.9 Plus
Ahcy89E-PD 504 CG8956-PD 48..486 757..2079 1899 78.9 Plus
Ahcy13-PC 432 CG11654-PC 16..427 850..2082 1132 53 Plus
Ahcy13-PA 432 CG11654-PA 16..427 850..2082 1132 53 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2768464..2769979 3020..1505 7565 99.9 Minus
3L 28110227 3L 2771268..2772323 1056..1 5280 100 Minus
3L 28110227 3L 2770041..2770493 1507..1055 2250 99.8 Minus
3R 32079331 3R 16979477..16980037 1406..846 795 76.1 Minus
3R 32079331 3R 16978592..16978699 2091..1984 195 78.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:36:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2768464..2769979 3020..1505 7565 99.9 Minus
3L 28103327 3L 2771268..2772323 1056..1 5280 100 Minus
3L 28103327 3L 2770041..2770493 1507..1055 2250 99.7 Minus
3R 31820162 3R 16720574..16720868 1140..846 575 79.6 Minus
3R 31820162 3R 16720482..16720547 1232..1167 210 87.8 Minus
3R 31820162 3R 16719423..16719530 2091..1984 195 78.7 Minus
3R 31820162 3R 16719663..16719855 1917..1725 185 73 Minus
3R 31820162 3R 1430309..1430368 1327..1386 165 85 Plus
X 23527363 X 15459802..15459861 1327..1386 165 85 Plus
3R 31820162 3R 1429943..1429995 964..1016 160 86.7 Plus
X 23527363 X 15458899..15458951 964..1016 160 86.7 Plus
Blast to na_te.dros performed on 2014-11-27 03:29:15 has no hits.

FI03221.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:54:59 Download gff for FI03221.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2770705..2771760 1..1056 100   Minus
chr3L 2769479..2769928 1057..1506 99 <- Minus
chr3L 2767903..2769414 1507..3018 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:58:59 Download gff for FI03221.complete
Subject Subject Range Query Range Percent Splice Strand
CG9977-RA 1..1566 535..2100 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:28:20 Download gff for FI03221.complete
Subject Subject Range Query Range Percent Splice Strand
CG9977-RA 1..1566 535..2100 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:43 Download gff for FI03221.complete
Subject Subject Range Query Range Percent Splice Strand
CG9977-RA 1..1566 535..2100 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:54:59 Download gff for FI03221.complete
Subject Subject Range Query Range Percent Splice Strand
CG9977-RA 1..1566 535..2100 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-14 20:04:04 Download gff for FI03221.complete
Subject Subject Range Query Range Percent Splice Strand
CG9977-RA 1..2136 1..2136 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:28:19 Download gff for FI03221.complete
Subject Subject Range Query Range Percent Splice Strand
CG9977-RA 1..2136 1..2136 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:43 Download gff for FI03221.complete
Subject Subject Range Query Range Percent Splice Strand
CG9977-RA 3..3020 1..3018 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:54:59 Download gff for FI03221.complete
Subject Subject Range Query Range Percent Splice Strand
CG9977-RA 3..3020 1..3018 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:54:59 Download gff for FI03221.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2771268..2772323 1..1056 100   Minus
3L 2770042..2770491 1057..1506 99 <- Minus
3L 2768466..2769977 1507..3018 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:43 Download gff for FI03221.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2771268..2772323 1..1056 100   Minus
arm_3L 2770042..2770491 1057..1506 99 <- Minus
arm_3L 2768466..2769977 1507..3018 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:01:05 Download gff for FI03221.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2771268..2772323 1..1056 100   Minus
3L 2770042..2770491 1057..1506 99 <- Minus
3L 2768466..2769977 1507..3018 99 <- Minus

FI03221.pep Sequence

Translation from 534 to 2099

> FI03221.pep
MNNLADTVVVDPGFGGGDKQQQAGPAPQDASVVVPPPATKQSSALKKTSR
YRSRSLSASSTDSFSSASYTGSSEDGDDVPPREKVQKNSKGSSDFCVRNI
GAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTHINAQTA
VLIETLVELGASVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFW
WCIDRCVNAENWQPNMILDDGGDATHLMLKKYPTMFKLVKGIVEESVTGV
HRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYSCKESILDSLKRSTDVMF
GGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQASMDGFRVVK
LNEVIRNVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGL
RTPDLTWEKVRSQVDHIIWPEGKYIILLAEGRLVNLSCSSIPSFAVSITS
ATQALALIELFNAPPGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSD
EQAKYMGLNKAGPFKPNYYRY*

FI03221.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 17:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10239-PA 521 GF10239-PA 1..521 1..521 2785 98.8 Plus
Dana\GF17919-PA 492 GF17919-PA 18..492 43..521 1968 76.6 Plus
Dana\GF21238-PA 432 GF21238-PA 16..432 106..521 1150 53.3 Plus
Dana\GF22777-PA 812 GF22777-PA 1..248 43..293 909 68.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 17:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14500-PA 521 GG14500-PA 1..521 1..521 2805 99.8 Plus
Dere\GG16804-PA 492 GG16804-PA 18..492 43..521 1974 76.8 Plus
Dere\GG17878-PA 432 GG17878-PA 16..432 106..521 1151 53.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 17:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15177-PA 523 GH15177-PA 2..523 1..521 2650 97.7 Plus
Dgri\GH18071-PA 491 GH18071-PA 18..491 43..520 1897 74.7 Plus
Dgri\GH24475-PA 434 GH24475-PA 18..434 106..521 1154 53.3 Plus
Dgri\GH23837-PA 187 GH23837-PA 1..184 299..483 741 77.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 17:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG9977-PA 521 CG9977-PA 1..521 1..521 2716 100 Plus
Ahcy89E-PC 492 CG8956-PC 18..492 43..521 1976 76.8 Plus
Ahcy89E-PD 504 CG8956-PD 18..491 43..520 1969 76.8 Plus
Ahcy13-PC 432 CG11654-PC 16..432 106..521 1154 53.1 Plus
Ahcy13-PA 432 CG11654-PA 16..432 106..521 1154 53.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 17:00:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12116-PA 522 GI12116-PA 1..522 1..521 2696 98.3 Plus
Dmoj\GI23750-PA 488 GI23750-PA 20..488 49..520 2026 78 Plus
Dmoj\GI15339-PA 432 GI15339-PA 16..432 106..521 1151 53.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 17:00:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18434-PA 486 GL18434-PA 1..486 1..521 2450 91.2 Plus
Dper\GL23551-PA 492 GL23551-PA 18..492 43..521 1956 77 Plus
Dper\GL14580-PA 432 GL14580-PA 6..432 95..521 1145 52.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 17:00:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29299-PA 509 GA29299-PA 1..509 1..521 2594 95.6 Plus
Dpse\GA27300-PA 492 GA27300-PA 18..492 43..521 1949 76.6 Plus
Dpse\GA11121-PA 432 GA11121-PA 16..432 106..521 1145 52.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 17:00:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14106-PA 521 GM14106-PA 1..521 1..521 2801 99.8 Plus
Dsec\GM15398-PA 492 GM15398-PA 18..492 43..521 1975 76.8 Plus
Dsec\GM19564-PA 432 GM19564-PA 16..432 106..521 1155 53.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 17:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13374-PA 521 GD13374-PA 1..521 1..521 2800 99.8 Plus
Dsim\GD20263-PA 492 GD20263-PA 18..492 43..521 1979 77 Plus
Dsim\GD17210-PA 432 GD17210-PA 16..432 106..521 1156 53.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 17:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13390-PA 522 GJ13390-PA 1..522 1..521 2697 98.1 Plus
Dvir\GJ10596-PA 487 GJ10596-PA 4..487 34..520 2024 77.2 Plus
Dvir\GJ16855-PA 432 GJ16855-PA 16..432 106..521 1152 53.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 17:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12540-PA 521 GK12540-PA 1..521 1..521 2688 97.5 Plus
Dwil\GK13850-PA 491 GK13850-PA 18..491 43..520 1948 78.7 Plus
Dwil\GK19859-PA 432 GK19859-PA 16..432 106..521 1160 53.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 17:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21691-PA 521 GE21691-PA 1..521 1..521 2802 99.6 Plus
Dyak\GE26121-PA 492 GE26121-PA 18..492 43..521 1990 77.2 Plus
Dyak\GE17184-PA 432 GE17184-PA 16..432 106..521 1154 53.1 Plus

FI03221.hyp Sequence

Translation from 534 to 2099

> FI03221.hyp
MNNLADTVVVDPGFGGGDKQQQAGPAPQDASVVVPPPATKQSSALKKTSR
YRSRSLSASSTDSFSSASYTGSSEDGDDVPPREKVQKNSKGSSDFCVRNI
GAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTHINAQTA
VLIETLVELGASVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFW
WCIDRCVNAENWQPNMILDDGGDATHLMLKKYPTMFKLVKGIVEESVTGV
HRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYSCKESILDSLKRSTDVMF
GGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQASMDGFRVVK
LNEVIRNVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGL
RTPDLTWEKVRSQVDHIIWPEGKYIILLAEGRLVNLSCSSIPSFAVSITS
ATQALALIELFNAPPGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSD
EQAKYMGLNKAGPFKPNYYRY*

FI03221.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG9977-PA 521 CG9977-PA 1..521 1..521 2716 100 Plus
Ahcy89E-PC 492 CG8956-PC 18..492 43..521 1976 76.8 Plus
Ahcy89E-PD 504 CG8956-PD 18..491 43..520 1969 76.8 Plus
Ahcy13-PC 432 CG11654-PC 16..432 106..521 1154 53.1 Plus
Ahcy13-PA 432 CG11654-PA 16..432 106..521 1154 53.1 Plus