Clone FI03225 Report

Search the DGRC for FI03225

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:32
Well:25
Vector:pFlc-1
Associated Gene/Transcriptltl-RA
Protein status:FI03225.pep: gold
Sequenced Size:3637

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32372 2008-12-18 5.12 accounting

Clone Sequence Records

FI03225.complete Sequence

3637 bp assembled on 2008-09-19

GenBank Submission: BT044551.1

> FI03225.complete
AGTTGATAATCCGCCGTCCGAGCGAATGCAACGTGTCCTGGTCTCGAGCC
GGAAAACCGTGATTTGTGAACTGTGAACCGAACTGTGAACTGAGATATCG
TAGATAGCGAAAAAGTGTACATATACAAATATATTATTGCTCTGGCCAAA
GAATTGTGAAATCGCATTCACCGAGTGACTGAGATCACTCTACGAAAATG
ACTTCCCTCGTGTACACCGTCTTTCACCTGGCCTCGCTGCAATGTTCCGT
GCGTCCGGAGATCTCGCCCTGCACCTGCGAAACGGGCAAAGCCTGGAATC
ATGTGGAGCTCTCCTGCGAGAAGTTGGAATCCTTCAACGCCGTCGTGGAC
AGCCTGGCCAATAAGCTCAATGCCGACACCAATATCGACCTAAAGATCAC
GCACTCGCAACTCGACGACCTGGAAATGCGCTCGTTTACGGATATGAACT
TCAACTTGTACAAGCTACGGATGCAGTGGAACAGTCTAAAATCGCTGCCC
GAGGTGCCGTTCCGCGGGTTATCGAATGTCACCTACCTAAGCATCGGCGA
CAACGACCTCGACGAGATCCCGAAGCACGCCCTGAGCCACATGCCGAGCC
TTTTGACTCTGGACATTGGGCGGTGCAAGATACGGGCGGTGCAGCAGGAG
GACTTCCGGGGCATACAGCGGGTAACGAATCTGATTCTGGTGAGCAACAT
CATTACGCGCCTGGACCGAGGATCCTTTCCCAAGAGCCTCCTCATCCTGC
ATCTGGGTAGAAACCAACTGGAGTCGCTGAATGGCTCGCTTCACGATCTG
CACAACTTGGAGTCTCTGTTCATCAATGCGAATAATATCACATCGCTGGA
TGATGAGCTACCCGATGGAGGGCAGTTGCGCCTCCTGATGGCTCACAATA
ATAGGTTGGAACGCCTGCCGGCCAATATGGCCGGTATGCACAGCCTGGAG
ACGGTCCACATACACTGCAACCAGCTGAGATCCTTCGACCGTGTACTTCG
CAATGCCGTCAATCTGTCCGAGGTCATGGCCGATAACAATGAGCTGGAGT
ACCTGGCCCAGGATGAATTCGCCTCCTGCTCCAAGGTGGAGACCCTGCAG
ATGGGCTGCAATCACATCAAGTCGCTCAACTCCTCGCTACTGCCCATCCT
CAAGCTGAAGAATGCCAACTTCTCGTTCAACGACATCGAAGAGTTCTCCA
TGGCGGAACTGCACGGATTGCGATCGCTGAAGACACTCCAGCTGTCCAGT
AATCGCATCCAACGACTGCTGCCCGATCCCCGGGGAGTGCAGGAGCTGAT
GCTTGTCAATCTGGATCTGGATAACAATAGAATCGACTCTCTGAATGGAG
CTTTGGCTGGCTTGGGCAATCTTCGGATACTCAATTTGGCTGGAAACCGA
TTGGAACATCTCCAGGTGGGCGATTTCGATGGCATGATTCGATTGGACAT
CCTCGACCTGACCGGGAATCAGCTAGCGGAGCTCAAGCCCTTGGAAATGA
CTTTGTTGCCCAGCCTGAAAATCCTTAAGGTTGCGTACAACAATATCACC
AAGCTGGAACAGGACTTCAAGGGACTGCCCGTGCTTTGCCAGGCCAACTT
GACCAATAACCAGATTTCGACCATATCGAGTGAACTCGTCACCAACACGC
GCTGCAAAAATCACAATGTTCCCGGCAAACTGGAGATACATCTAGATGAC
AATCCCATAATGTGTGACGTGGGATTGAACGAGCTGTGTCGATTGATGGC
CGTTCAGGAGGCACGAATTCGTGGTCGATCCCAGTGCTTTGAGAATGACC
AGGAGGTGTGCACCGTGCTCCCGATGCTATACAATGTGAACCTGCCCATA
ATGGTGACCAATCTAAAGTTGACGGGCCGCGAGGTTCCAAAGCCGATGGT
TCGGGTGATCGTACCATCGCTGATCAAGGCCAATAATGAGCTATTACCGC
CACTTATTGCCACTCTGGGTAATCCAGTGCTCATTAGCACCGATTTGGTC
AATCCGGTGATATCGCCACTACCACCACCACTTCTGCTGGCCACCACAAC
GCCGCCACCGCCTCTGCCACTTCCTGTGGAATCGGAAGTTGAGAAGAATG
AGTCTACCACTGCGAATCCAGTGCCAACCAATTACACACAGGAGACCACG
ACAACCACAAGTACCACAACGACGACAACAACAACGGAGACCAGTAGTCA
GGTGGCTCCCATCGAGATTATTACGACTACAGCACCCACGACGACTACCA
CCAGCACCACAACACCGAAACCCAATGAAACGCTGCCCGTGATTGTGGAA
CTCCAGGATCCCAATCCACCGGACACTACAGTCAATCAAACTGCCCTCGT
TCCGCCAGTGGTTCTAGATCCCCTGCAGCAGGATCTGGAAAGGGAGAGGG
AACGCGAAAGGGAGCGAGAACTAGAGCGGGATCTGGACCACGAGGCGGTG
GCCAAGACCGAGTACGAGACGGTCGAGTACATCCCCAATCTGGTGCAGCC
TCCAGTGGGCAGTGATGCACTGACGCCGCCTCCGAGCAAGGCGAATGCGC
TGGAGGAGGACTCCGAGTCGGTGCACTCTAACTCAGTGCACGCGGAGTAT
CCCCACGCGGCGCAGAGCCTCCAGATTCCCGAGGAACCGCCGGAGGAGTG
AGTCCTCCGCCTGGGGGTTTGGCTCCTCGGGGGGAATCCCCCGAAAATAA
CCACATTATTTTACTGTAAATCGCAGAGGGATGGAGGCGGTGGAATCGAT
GGAGAGCGGACGGAGCAGCATGCAAACGGCGGAAGGAGCGAGTTTCGGAT
TTGTATGCCTTAAGTTAACTTAGTTCTTATGTTTTATTTAAGCCATCGCT
AAATCGAACAGTTTGTCAGACCAAACGCTTTTTTGTTGAGTTTTTTCGTC
GATTTTATGCAAAATTTGATACGATTACTGGGTTTTTGATGTAATCCTGC
ATTCGGGACAAACGTACGAGGACAGTCTTATGATTTAAGCTTATTTGTTG
GGGGCTCAATTTCGCGTATGTGTGCTTCGGCGTTGGCAAGCGGAACTCTT
TCGGTTTTCAATTTCACGGAATTTTAAACTATTTGCAGAAAACAATCCAA
ATATATAAATTATGTATTTTAAAATCTCTTAAATATCTAGAGCTGATACA
TTGATACATTGAAACACATCGAAATGGGTGATATATTTTCCGCTGGTTTA
GTATGATCATAAAAAATAAATTGAAACAAACCGTGAAATTAAAAAACGAA
AGCAAGACCGATAGAAACAGGAAGTTGGCGATATCGAATATGCAACTGCA
TATGCACATTATATATATTTAATAACTGTATACACGTATGAACGTTGAAC
ATCTACAAGTAGGTACTTAGAGTTAAACGACAGCAACAACAAATCGCATC
GAGCTAATGTTAATAACGAAAAGCACTCACTCACATACAAACACACAAAA
CCACACACACACAAACACAGCCGTAGTCGTGCACATGCACAAACTGAAAA
AAAATACGAATAAAAAAAAACGAGAAAATATATTGTTATCAGTTCGTTAA
CAAAATGAGAAAATAGATTTTAGCGTGTAATTATACGAAAATGAAAATGG
TATTCTAAATAAAATCATAAACAAAAAAAAAAAAAAA

FI03225.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG32372.a 4133 CG32372.a 503..4127 1..3626 18060 99.9 Plus
CG32372-RA 3631 CG32372-RA 1..3625 1..3626 18060 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7518192..7520108 1698..3621 8965 98.3 Plus
chr3L 24539361 chr3L 7516585..7517593 491..1499 4910 99.1 Plus
chr3L 24539361 chr3L 7511585..7512074 1..490 2450 100 Plus
chr3L 24539361 chr3L 7517654..7517853 1499..1698 1000 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
ltl-RB 2454 CG32372-PB 1..2454 198..2651 12270 100 Plus
ltl-RA 2454 CG32372-PA 1..2454 198..2651 12270 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:35 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
ltl-RB 4108 CG32372-RB 492..4108 1..3618 18025 99.9 Plus
ltl-RA 3622 CG32372-RA 6..3622 1..3618 18025 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
ltl-PB 817 CG32372-PB 1..810 198..2627 3570 100 Plus
ltl-PA 817 CG32372-PA 1..810 198..2627 3570 100 Plus
atk-PC 1535 CG5195-PC 387..838 390..1745 267 25.6 Plus
atk-PB 1535 CG5195-PB 387..838 390..1745 267 25.6 Plus
atk-PA 1535 CG5195-PA 387..838 390..1745 267 25.6 Plus
atk-PC 1535 CG5195-PC 116..495 384..1631 215 25.1 Plus
atk-PB 1535 CG5195-PB 116..495 384..1631 215 25.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7526094..7528021 1698..3626 9565 99.8 Plus
3L 28110227 3L 7524487..7525495 491..1499 5045 100 Plus
3L 28110227 3L 7519488..7519977 1..490 2450 100 Plus
3L 28110227 3L 7525556..7525755 1499..1698 1000 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7519194..7521121 1698..3626 9575 99.8 Plus
3L 28103327 3L 7517587..7518595 491..1499 5045 100 Plus
3L 28103327 3L 7512588..7513077 1..490 2450 100 Plus
3L 28103327 3L 7518656..7518855 1499..1698 1000 100 Plus
Blast to na_te.dros performed 2014-11-27 11:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1041..1097 3130..3072 146 74.6 Minus

FI03225.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:50:36 Download gff for FI03225.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7518193..7520108 1699..3622 95   Plus
chr3L 7517655..7517853 1500..1698 100 -> Plus
chr3L 7516585..7517593 491..1499 99 -> Plus
chr3L 7511585..7512074 1..490 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:42:53 Download gff for FI03225.complete
Subject Subject Range Query Range Percent Splice Strand
CG32372-RA 1..2454 198..2651 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:13:02 Download gff for FI03225.complete
Subject Subject Range Query Range Percent Splice Strand
CG32372-RA 1..2454 198..2651 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:28:13 Download gff for FI03225.complete
Subject Subject Range Query Range Percent Splice Strand
ltl-RA 1..2454 198..2651 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:50:36 Download gff for FI03225.complete
Subject Subject Range Query Range Percent Splice Strand
ltl-RA 1..2454 198..2651 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:50:55 Download gff for FI03225.complete
Subject Subject Range Query Range Percent Splice Strand
CG32372-RA 1..3620 1..3621 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:13:02 Download gff for FI03225.complete
Subject Subject Range Query Range Percent Splice Strand
CG32372-RA 1..3620 1..3621 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:28:13 Download gff for FI03225.complete
Subject Subject Range Query Range Percent Splice Strand
ltl-RA 6..3622 1..3618 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-19 19:29:09 Download gff for FI03225.complete
Subject Subject Range Query Range Percent Splice Strand
CG32372-RA 1..3620 1..3621 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:50:36 Download gff for FI03225.complete
Subject Subject Range Query Range Percent Splice Strand
ltl-RA 6..3622 1..3618 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:50:36 Download gff for FI03225.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7526095..7528016 1699..3622 99   Plus
3L 7525557..7525755 1500..1698 100 -> Plus
3L 7524487..7525495 491..1499 100 -> Plus
3L 7519488..7519977 1..490 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:28:13 Download gff for FI03225.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7519195..7521116 1699..3622 99   Plus
arm_3L 7518657..7518855 1500..1698 100 -> Plus
arm_3L 7517587..7518595 491..1499 100 -> Plus
arm_3L 7512588..7513077 1..490 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:43:36 Download gff for FI03225.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7519195..7521116 1699..3622 99   Plus
3L 7518657..7518855 1500..1698 100 -> Plus
3L 7517587..7518595 491..1499 100 -> Plus
3L 7512588..7513077 1..490 100 -> Plus

FI03225.pep Sequence

Translation from 197 to 2650

> FI03225.pep
MTSLVYTVFHLASLQCSVRPEISPCTCETGKAWNHVELSCEKLESFNAVV
DSLANKLNADTNIDLKITHSQLDDLEMRSFTDMNFNLYKLRMQWNSLKSL
PEVPFRGLSNVTYLSIGDNDLDEIPKHALSHMPSLLTLDIGRCKIRAVQQ
EDFRGIQRVTNLILVSNIITRLDRGSFPKSLLILHLGRNQLESLNGSLHD
LHNLESLFINANNITSLDDELPDGGQLRLLMAHNNRLERLPANMAGMHSL
ETVHIHCNQLRSFDRVLRNAVNLSEVMADNNELEYLAQDEFASCSKVETL
QMGCNHIKSLNSSLLPILKLKNANFSFNDIEEFSMAELHGLRSLKTLQLS
SNRIQRLLPDPRGVQELMLVNLDLDNNRIDSLNGALAGLGNLRILNLAGN
RLEHLQVGDFDGMIRLDILDLTGNQLAELKPLEMTLLPSLKILKVAYNNI
TKLEQDFKGLPVLCQANLTNNQISTISSELVTNTRCKNHNVPGKLEIHLD
DNPIMCDVGLNELCRLMAVQEARIRGRSQCFENDQEVCTVLPMLYNVNLP
IMVTNLKLTGREVPKPMVRVIVPSLIKANNELLPPLIATLGNPVLISTDL
VNPVISPLPPPLLLATTTPPPPLPLPVESEVEKNESTTANPVPTNYTQET
TTTTSTTTTTTTTETSSQVAPIEIITTTAPTTTTTSTTTPKPNETLPVIV
ELQDPNPPDTTVNQTALVPPVVLDPLQQDLERERERERERELERDLDHEA
VAKTEYETVEYIPNLVQPPVGSDALTPPPSKANALEEDSESVHSNSVHAE
YPHAAQSLQIPEEPPEE*

FI03225.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 19:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10651-PA 817 GF10651-PA 1..817 1..817 2962 74.4 Plus
Dana\GF24129-PA 1536 GF24129-PA 386..826 65..476 250 27.2 Plus
Dana\GF11863-PA 1187 GF11863-PA 189..549 65..417 239 27 Plus
Dana\GF18811-PA 1407 GF18811-PA 335..707 65..476 233 26.7 Plus
Dana\GF18811-PA 1407 GF18811-PA 187..629 86..526 231 24.5 Plus
Dana\GF13491-PA 1082 GF13491-PA 193..656 65..477 231 25.3 Plus
Dana\GF24129-PA 1536 GF24129-PA 104..642 47..483 212 24.1 Plus
Dana\GF18811-PA 1407 GF18811-PA 434..923 13..476 210 23.1 Plus
Dana\GF24129-PA 1536 GF24129-PA 234..728 63..505 208 26.6 Plus
Dana\GF18811-PA 1407 GF18811-PA 23..584 8..504 202 25.5 Plus
Dana\GF18811-PA 1407 GF18811-PA 184..689 39..482 195 20.9 Plus
Dana\GF11863-PA 1187 GF11863-PA 209..484 180..476 188 29.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 19:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14437-PA 825 GG14437-PA 1..825 1..817 3631 94 Plus
Dere\GG20576-PA 1259 GG20576-PA 252..614 65..419 248 27.4 Plus
Dere\GG11714-PA 1395 GG11714-PA 333..788 65..487 233 24.8 Plus
Dere\GG10165-PA 1369 GG10165-PA 217..582 64..429 232 27.3 Plus
Dere\GG13307-PA 1535 GG13307-PA 387..811 65..484 231 26.1 Plus
Dere\GG11714-PA 1395 GG11714-PA 185..617 86..484 217 25.6 Plus
Dere\GG11714-PA 1395 GG11714-PA 17..518 4..481 211 26.4 Plus
Dere\GG20576-PA 1259 GG20576-PA 245..547 177..476 202 28.8 Plus
Dere\GG10165-PA 1369 GG10165-PA 199..577 95..471 193 24.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 19:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14894-PA 808 GH14894-PA 1..807 1..816 2471 62.9 Plus
Dgri\GH21794-PA 1091 GH21794-PA 255..668 67..477 243 24.7 Plus
Dgri\GH17015-PA 1548 GH17015-PA 387..827 65..476 222 25.9 Plus
Dgri\GH11192-PA 1247 GH11192-PA 66..538 95..516 217 25.1 Plus
Dgri\GH17015-PA 1548 GH17015-PA 527..931 89..514 213 24.3 Plus
Dgri\GH14531-PA 1400 GH14531-PA 206..594 95..453 213 27.2 Plus
Dgri\GH17015-PA 1548 GH17015-PA 105..538 47..476 212 24.2 Plus
Dgri\GH17015-PA 1548 GH17015-PA 235..729 63..505 203 26.9 Plus
Dgri\GH21794-PA 1091 GH21794-PA 396..905 65..520 191 25.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
ltl-PB 817 CG32372-PB 1..817 1..817 4194 100 Plus
ltl-PA 817 CG32372-PA 1..817 1..817 4194 100 Plus
lbk-PB 1252 CG8434-PB 296..658 65..419 300 27.2 Plus
conv-PA 1092 CG8561-PA 394..903 65..520 282 25.9 Plus
conv-PB 1092 CG8561-PB 394..903 65..520 282 25.9 Plus
conv-PA 1092 CG8561-PA 253..666 67..477 263 23.5 Plus
lbk-PB 1252 CG8434-PB 290..613 178..498 257 27.9 Plus
conv-PA 1092 CG8561-PA 179..570 90..478 234 22.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 19:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12870-PA 803 GI12870-PA 1..803 1..817 2557 65 Plus
Dmoj\GI10798-PA 1394 GI10798-PA 336..694 79..476 247 27.2 Plus
Dmoj\GI10798-PA 1394 GI10798-PA 191..646 55..476 224 23.5 Plus
Dmoj\GI11909-PA 1550 GI11909-PA 527..931 89..514 224 24.5 Plus
Dmoj\GI11909-PA 1550 GI11909-PA 387..806 65..479 224 25.4 Plus
Dmoj\GI21098-PA 1417 GI21098-PA 148..571 105..481 223 26 Plus
Dmoj\GI11909-PA 1550 GI11909-PA 235..670 63..486 217 28 Plus
Dmoj\GI20543-PA 1093 GI20543-PA 255..668 67..477 215 24.7 Plus
Dmoj\GI11909-PA 1550 GI11909-PA 105..538 47..476 210 26.1 Plus
Dmoj\GI21098-PA 1417 GI21098-PA 244..697 65..516 191 24.8 Plus
Dmoj\GI10798-PA 1394 GI10798-PA 79..503 69..477 173 26 Plus
Dmoj\GI10798-PA 1394 GI10798-PA 421..937 13..477 166 22.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 19:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26536-PA 832 GL26536-PA 1..832 1..817 2772 68.6 Plus
Dper\GL12775-PA 1549 GL12775-PA 408..827 87..476 242 27.7 Plus
Dper\GL14012-PA 1409 GL14012-PA 99..593 30..483 229 24.1 Plus
Dper\GL14012-PA 1409 GL14012-PA 334..789 65..487 228 25.4 Plus
Dper\GL10699-PA 1280 GL10699-PA 253..577 65..429 224 27.4 Plus
Dper\GL12775-PA 1549 GL12775-PA 235..661 63..477 222 28.7 Plus
Dper\GL21062-PA 1381 GL21062-PA 256..600 86..429 214 28.7 Plus
Dper\GL12775-PA 1549 GL12775-PA 105..643 47..483 211 24.5 Plus
Dper\GL12775-PA 1549 GL12775-PA 479..931 53..514 210 24 Plus
Dper\GL10699-PA 1280 GL10699-PA 245..548 176..476 200 28.5 Plus
Dper\GL14012-PA 1409 GL14012-PA 433..949 13..477 197 22.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 19:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16850-PA 807 GA16850-PA 1..807 1..817 2805 70.6 Plus
Dpse\GA18727-PA 1550 GA18727-PA 408..827 87..476 238 27.4 Plus
Dpse\GA20668-PA 1408 GA20668-PA 186..593 86..483 229 24.9 Plus
Dpse\GA20668-PA 1408 GA20668-PA 334..789 65..487 228 25.4 Plus
Dpse\GA18727-PA 1550 GA18727-PA 235..661 63..477 225 29 Plus
Dpse\GA21075-PA 1335 GA21075-PA 308..632 65..429 224 27.4 Plus
Dpse\GA21416-PA 1374 GA21416-PA 228..593 64..429 217 27.5 Plus
Dpse\GA18727-PA 1550 GA18727-PA 105..643 47..483 214 24.7 Plus
Dpse\GA18727-PA 1550 GA18727-PA 479..931 53..514 209 24 Plus
Dpse\GA20668-PA 1408 GA20668-PA 433..949 13..477 200 23.4 Plus
Dpse\GA21075-PA 1335 GA21075-PA 300..603 176..476 200 28.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 19:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14853-PA 826 GM14853-PA 1..826 1..817 3723 95.9 Plus
Dsec\GM21667-PA 1197 GM21667-PA 203..565 65..419 249 27.6 Plus
Dsec\GM14985-PA 1286 GM14985-PA 229..573 86..429 232 28.4 Plus
Dsec\GM22211-PA 1535 GM22211-PA 387..811 65..484 225 25.9 Plus
Dsec\GM12844-PA 1224 GM12844-PA 185..618 86..487 217 23 Plus
Dsec\GM21667-PA 1197 GM21667-PA 196..498 177..476 205 29.2 Plus
Dsec\GM22211-PA 1535 GM22211-PA 105..643 47..483 204 24.4 Plus
Dsec\GM22211-PA 1535 GM22211-PA 235..729 63..505 199 26.5 Plus
Dsec\GM14985-PA 1286 GM14985-PA 190..568 95..471 197 24.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 19:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14023-PA 827 GD14023-PA 1..827 1..817 3747 97.5 Plus
Dsim\GD11167-PA 1197 GD11167-PA 203..565 65..419 253 27.6 Plus
Dsim\GD12183-PA 1535 GD12183-PA 387..827 65..476 236 26.8 Plus
Dsim\GD22022-PA 1358 GD22022-PA 227..571 86..429 232 28.4 Plus
Dsim\GD21488-PA 962 GD21488-PA 333..705 65..476 219 26.3 Plus
Dsim\GD11167-PA 1197 GD11167-PA 196..498 177..476 211 29.5 Plus
Dsim\GD12183-PA 1535 GD12183-PA 105..521 47..480 203 26.4 Plus
Dsim\GD22022-PA 1358 GD22022-PA 188..566 95..471 198 24.2 Plus
Dsim\GD12183-PA 1535 GD12183-PA 235..726 63..502 194 26.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 19:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13011-PA 831 GJ13011-PA 1..831 1..817 2692 68.2 Plus
Dvir\GJ14396-PA 1388 GJ14396-PA 347..699 87..476 247 26.6 Plus
Dvir\GJ21421-PA 1235 GJ21421-PA 235..576 87..419 232 28.5 Plus
Dvir\GJ22393-PA 1064 GJ22393-PA 232..668 45..477 225 24.6 Plus
Dvir\GJ20945-PA 1417 GJ20945-PA 47..570 14..481 220 24.3 Plus
Dvir\GJ14396-PA 1388 GJ14396-PA 178..586 86..483 204 24.4 Plus
Dvir\GJ14396-PA 1388 GJ14396-PA 230..651 63..476 186 24.2 Plus
Dvir\GJ21421-PA 1235 GJ21421-PA 201..545 97..483 176 27.2 Plus
Dvir\GJ14396-PA 1388 GJ14396-PA 83..511 69..481 173 26.2 Plus
Dvir\GJ14396-PA 1388 GJ14396-PA 493..942 87..477 164 23.9 Plus
Dvir\GJ22393-PA 1064 GJ22393-PA 396..829 65..450 159 25.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 19:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17391-PA 827 GK17391-PA 1..827 1..817 2526 66.9 Plus
Dwil\GK20783-PA 1096 GK20783-PA 255..668 67..477 247 25.5 Plus
Dwil\GK12340-PA 1553 GK12340-PA 410..813 87..484 235 26.6 Plus
Dwil\GK13202-PA 1397 GK13202-PA 185..582 86..473 228 25.9 Plus
Dwil\GK12340-PA 1553 GK12340-PA 529..933 89..514 222 25 Plus
Dwil\GK24081-PA 538 GK24081-PA 26..516 27..543 219 24.5 Plus
Dwil\GK12340-PA 1553 GK12340-PA 236..645 63..483 213 25.6 Plus
Dwil\GK13202-PA 1397 GK13202-PA 182..688 39..483 203 21.7 Plus
Dwil\GK12340-PA 1553 GK12340-PA 106..519 47..476 197 25.7 Plus
Dwil\GK20783-PA 1096 GK20783-PA 33..526 16..476 177 22.8 Plus
Dwil\GK20783-PA 1096 GK20783-PA 396..844 65..476 177 25.6 Plus
Dwil\GK20783-PA 1096 GK20783-PA 181..570 90..476 172 22.2 Plus
Dwil\GK13202-PA 1397 GK13202-PA 333..788 65..487 168 21 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 19:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21627-PA 829 GE21627-PA 1..829 1..817 3703 95.7 Plus
Dyak\GE11761-PA 1202 GE11761-PA 197..559 65..419 253 27.9 Plus
Dyak\GE22397-PA 1534 GE22397-PA 386..810 65..484 237 26.3 Plus
Dyak\GE25192-PA 1364 GE25192-PA 212..577 64..429 234 27.3 Plus
Dyak\GE23905-PA 1121 GE23905-PA 329..784 65..487 229 24 Plus
Dyak\GE11761-PA 1202 GE11761-PA 190..492 177..476 201 28.8 Plus
Dyak\GE25192-PA 1364 GE25192-PA 194..572 95..471 195 24.7 Plus
Dyak\GE22397-PA 1534 GE22397-PA 234..728 63..505 190 26.2 Plus
Dyak\GE22397-PA 1534 GE22397-PA 115..451 63..483 163 22.6 Plus

FI03225.hyp Sequence

Translation from 197 to 2650

> FI03225.hyp
MTSLVYTVFHLASLQCSVRPEISPCTCETGKAWNHVELSCEKLESFNAVV
DSLANKLNADTNIDLKITHSQLDDLEMRSFTDMNFNLYKLRMQWNSLKSL
PEVPFRGLSNVTYLSIGDNDLDEIPKHALSHMPSLLTLDIGRCKIRAVQQ
EDFRGIQRVTNLILVSNIITRLDRGSFPKSLLILHLGRNQLESLNGSLHD
LHNLESLFINANNITSLDDELPDGGQLRLLMAHNNRLERLPANMAGMHSL
ETVHIHCNQLRSFDRVLRNAVNLSEVMADNNELEYLAQDEFASCSKVETL
QMGCNHIKSLNSSLLPILKLKNANFSFNDIEEFSMAELHGLRSLKTLQLS
SNRIQRLLPDPRGVQELMLVNLDLDNNRIDSLNGALAGLGNLRILNLAGN
RLEHLQVGDFDGMIRLDILDLTGNQLAELKPLEMTLLPSLKILKVAYNNI
TKLEQDFKGLPVLCQANLTNNQISTISSELVTNTRCKNHNVPGKLEIHLD
DNPIMCDVGLNELCRLMAVQEARIRGRSQCFENDQEVCTVLPMLYNVNLP
IMVTNLKLTGREVPKPMVRVIVPSLIKANNELLPPLIATLGNPVLISTDL
VNPVISPLPPPLLLATTTPPPPLPLPVESEVEKNESTTANPVPTNYTQET
TTTTSTTTTTTTTETSSQVAPIEIITTTAPTTTTTSTTTPKPNETLPVIV
ELQDPNPPDTTVNQTALVPPVVLDPLQQDLERERERERERELERDLDHEA
VAKTEYETVEYIPNLVQPPVGSDALTPPPSKANALEEDSESVHSNSVHAE
YPHAAQSLQIPEEPPEE*

FI03225.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
ltl-PB 817 CG32372-PB 1..817 1..817 4194 100 Plus
ltl-PA 817 CG32372-PA 1..817 1..817 4194 100 Plus
lbk-PB 1252 CG8434-PB 296..658 65..419 300 27.2 Plus
conv-PA 1092 CG8561-PA 394..903 65..520 282 25.9 Plus
conv-PB 1092 CG8561-PB 394..903 65..520 282 25.9 Plus
conv-PA 1092 CG8561-PA 253..666 67..477 263 23.5 Plus
lbk-PB 1252 CG8434-PB 290..613 178..498 257 27.9 Plus
conv-PA 1092 CG8561-PA 179..570 90..478 234 22.2 Plus