Clone FI03233 Report

Search the DGRC for FI03233

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:32
Well:33
Vector:pFlc-1
Associated Gene/TranscriptCdk8-RA
Protein status:FI03233.pep: gold
Sequenced Size:1524

Clone Sequence Records

FI03233.complete Sequence

1524 bp assembled on 2009-10-06

GenBank Submission: BT099963.1

> FI03233.complete
ATCATCATTTACAAACAATTGTGGAATTTGCAAACTTTTGTAAAAATGGA
CTACGATTTCAAGATGAAAACGCAGATAGAGCGTACGAAAGTGGAGGACC
TATTCAACTACGAGGGCTGTAAGGTGGGACGCGGAACATACGGCCACGTC
TACAAGGCGAAATGGAAGGAGACAAGCGATGGCAAAGAATATGCCTTGAA
GCAGATCGACGGCACCGGATTGTCCATGTCCGCCTGCCGCGAGATCGCAT
TGCTGCGCGAACTGAAGCATCAGAACGTAATTACCCTCATCCGGGTGTTT
CTGTCGCACAACGACCGCAAGGTGTTCCTGTTGATCGACTATGCGGAGCA
CGACCTGTGGCACATCATTAAGTTCCATCGGGCTGCTAAGGCCACCAAAA
AGCAGGTTGTGGTTCCCCGCGGTATGGTTAAAAGTCTGCTATATCAGATT
CTGGATGGGATTCACTATCTGCACAGTAATTGGGTGCTACATCGTGACCT
GAAGCCGGCCAACATCCTGGTGATGGGCGATGGCAACGAGAGGGGCCGCG
TAAAAATCGCCGACATGGGTTTCGCGCGGCTCTTCAATGCCCCATTGAAA
CCGCTGGCAGATCTGGATCCCGTGGTGGTTACCTTTTGGTATCGCGCTCC
GGAACTGCTGCTTGGCGCTCGTCACTACACCAAGGCTATCGACATCTGGG
CTATTGGCTGTATTTTCGCCGAACTACTCACTTCGGAGCCCATCTTCCAT
TGCCGCCAGGAGGACATAAAGACCAGTAATCCGTACCATCACGATCAGCT
AGACCGCATCTTCAATGTGATGGGCTTTCCGCAGGACAAGGACTGGGAGG
ATATCAAGAAGATGCCGGAACATCATACGCTGACAAAGGACTTTAAACGC
TCCACATACTCCACCTGCTCGCTGGCCAAATACATGGAAAGGCACAAAAT
AAAGCCAGACAGCAAGGCCTTTCACCTGCTGCAGAAGCTGCTGCTAATGG
ATCCCAACAAGCGCATCACCTCCGAACAGGCCATGCAGGATCAGTACTTC
CAGGAGGAGCCGCAGCCCACGCAGGACGTGTTCGCCGGCTGCCCCATACC
GTATCCCAAGCGTGAATTCCTCACCGACGACGACCAGGAAGATAAGTCGG
ATAATAAGCGACAGCAGCAACAGCAGCAGCAACAACAGCAGCAACAGCAG
CAGCAACAGCAGCAGCAACAACAACAGCAGCAGCAGCAGCAGCAAATGAA
CGCTGAGCCGAATGCAAAGAGAGTTCGATTGTCCGGAGCTGGTAACCAGC
AAGATTTTCACCACCAGCAGCAGCAGCAACAGCAGCAGCAGCAACAACAG
CAGCAGCAGCAGCAACAGATGATGTTCAATCAGCAGCAGAACTTCCAGCG
CTTCAACTGAGAGACTGATACATGCAGCATTTTTTCTACAACACCTACTA
ATTTCTAGCCTTCTAAGTATTTAATTTAATGACCTTGATAATAGCAAGTA
AAGTGTACGAAAAAAAAAAAAAAA

FI03233.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Cdk8-RA 1640 Cdk8-RA 75..1591 1..1517 7540 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9828892..9830229 1509..175 6400 98.7 Minus
chr3L 24539361 chr3L 9830290..9830465 176..1 835 98.3 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Cdk8-RA 1365 CG10572-PA 1..1365 46..1410 6825 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:39 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Cdk8-RA 1529 CG10572-RA 21..1529 1..1509 7530 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
Cdk8-PA 454 CG10572-PA 1..416 46..1293 2050 100 Plus
Cdk2-PC 314 CG10498-PC 13..288 121..1053 492 36.2 Plus
Cdk2-PB 314 CG10498-PB 13..288 121..1053 492 36.2 Plus
Cdk2-PA 314 CG10498-PA 13..288 121..1053 492 36.2 Plus
Pitslre-PG 778 CG4268-PG 389..683 121..1068 489 35.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9837072..9838414 1517..175 6685 99.9 Minus
3L 28110227 3L 9838475..9838650 176..1 865 99.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9830172..9831514 1517..175 6685 99.8 Minus
3L 28103327 3L 9831575..9831750 176..1 865 99.4 Minus
Blast to na_te.dros performed on 2014-11-27 02:27:26 has no hits.

FI03233.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:55:10 Download gff for FI03233.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9830290..9830465 1..176 98   Minus
chr3L 9829248..9830227 177..1156 98 <- Minus
chr3L 9829087..9829156 1245..1314 100 == Minus
chr3L 9828892..9829032 1369..1509 99 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:48 Download gff for FI03233.complete
Subject Subject Range Query Range Percent Splice Strand
Cdk8-RA 1..1365 46..1410 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:41:21 Download gff for FI03233.complete
Subject Subject Range Query Range Percent Splice Strand
Cdk8-RA 1..1365 46..1410 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:49 Download gff for FI03233.complete
Subject Subject Range Query Range Percent Splice Strand
Cdk8-RA 1..1365 46..1410 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:55:10 Download gff for FI03233.complete
Subject Subject Range Query Range Percent Splice Strand
Cdk8-RA 1..1365 46..1410 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-06 14:14:53 Download gff for FI03233.complete
Subject Subject Range Query Range Percent Splice Strand
Cdk8-RA 1..1504 1..1504 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:41:21 Download gff for FI03233.complete
Subject Subject Range Query Range Percent Splice Strand
Cdk8-RA 1..1504 1..1504 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:49 Download gff for FI03233.complete
Subject Subject Range Query Range Percent Splice Strand
Cdk8-RA 42..1550 1..1509 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:55:10 Download gff for FI03233.complete
Subject Subject Range Query Range Percent Splice Strand
Cdk8-RA 21..1529 1..1509 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:55:10 Download gff for FI03233.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9838475..9838650 1..176 99   Minus
3L 9837080..9838412 177..1509 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:49 Download gff for FI03233.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9831575..9831750 1..176 99   Minus
arm_3L 9830180..9831512 177..1509 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:22:59 Download gff for FI03233.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9831575..9831750 1..176 99   Minus
3L 9830180..9831512 177..1509 100 <- Minus

FI03233.pep Sequence

Translation from 0 to 1409

> FI03233.pep
IIIYKQLWNLQTFVKMDYDFKMKTQIERTKVEDLFNYEGCKVGRGTYGHV
YKAKWKETSDGKEYALKQIDGTGLSMSACREIALLRELKHQNVITLIRVF
LSHNDRKVFLLIDYAEHDLWHIIKFHRAAKATKKQVVVPRGMVKSLLYQI
LDGIHYLHSNWVLHRDLKPANILVMGDGNERGRVKIADMGFARLFNAPLK
PLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFH
CRQEDIKTSNPYHHDQLDRIFNVMGFPQDKDWEDIKKMPEHHTLTKDFKR
STYSTCSLAKYMERHKIKPDSKAFHLLQKLLLMDPNKRITSEQAMQDQYF
QEEPQPTQDVFAGCPIPYPKREFLTDDDQEDKSDNKRQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQMNAEPNAKRVRLSGAGNQQDFHHQQQQQQQQQQQQ
QQQQQQMMFNQQQNFQRFN*

FI03233.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10227-PA 452 GF10227-PA 1..412 16..431 2077 97.1 Plus
Dana\GF10359-PA 942 GF10359-PA 553..847 41..356 517 36.1 Plus
Dana\GF16690-PA 314 GF16690-PA 13..288 41..351 507 36.5 Plus
Dana\GF22626-PA 294 GF22626-PA 9..289 41..353 473 37.1 Plus
Dana\GF14103-PA 297 GF14103-PA 9..288 41..351 460 34.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14001-PA 450 GG14001-PA 1..412 16..431 2109 99 Plus
Dere\GG16135-PA 968 GG16135-PA 579..873 41..356 508 35.2 Plus
Dere\GG24088-PA 314 GG24088-PA 13..288 41..351 484 35.9 Plus
Dere\GG22344-PA 294 GG22344-PA 9..289 41..353 477 37.4 Plus
Dere\GG23938-PA 297 GG23938-PA 9..288 41..351 463 34.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16999-PA 460 GH16999-PA 1..460 16..469 2133 95.2 Plus
Dgri\GH22186-PA 460 GH22186-PA 1..460 16..469 2133 95.2 Plus
Dgri\GH19966-PA 388 GH19966-PA 60..345 41..356 492 33.8 Plus
Dgri\GH17244-PA 314 GH17244-PA 2..288 28..351 478 35.1 Plus
Dgri\GH13856-PA 298 GH13856-PA 9..288 41..351 473 35.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:04:50
Subject Length Description Subject Range Query Range Score Percent Strand
Cdk8-PA 454 CG10572-PA 1..454 16..469 2423 100 Plus
Cdk2-PC 314 CG10498-PC 13..288 41..351 492 36.2 Plus
Cdk2-PB 314 CG10498-PB 13..288 41..351 492 36.2 Plus
Cdk2-PA 314 CG10498-PA 13..288 41..351 492 36.2 Plus
Pitslre-PG 778 CG4268-PG 389..683 41..356 489 35.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11413-PA 458 GI11413-PA 1..422 16..431 2053 96.7 Plus
Dmoj\GI11885-PA 967 GI11885-PA 576..870 41..356 494 36.4 Plus
Dmoj\GI22478-PA 298 GI22478-PA 3..295 36..356 481 35.9 Plus
Dmoj\GI10591-PA 314 GI10591-PA 13..288 41..351 471 36 Plus
Dmoj\GI18275-PA 297 GI18275-PA 9..288 41..351 467 35.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20758-PA 453 GL20758-PA 1..418 16..431 2082 98.8 Plus
Dper\GL12811-PA 989 GL12811-PA 593..887 41..356 520 36.6 Plus
Dper\GL27348-PA 314 GL27348-PA 13..288 41..351 492 37.5 Plus
Dper\GL10557-PA 388 GL10557-PA 60..344 41..355 479 33.1 Plus
Dper\GL11507-PA 294 GL11507-PA 9..289 41..353 476 37.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28311-PA 453 GA28311-PA 1..418 16..431 2082 98.8 Plus
Dpse\GA18070-PA 989 GA18070-PA 593..887 41..356 520 36.6 Plus
Dpse\GA10356-PA 314 GA10356-PA 13..288 41..351 492 37.5 Plus
Dpse\GA12412-PA 388 GA12412-PA 60..344 41..355 479 33.1 Plus
Dpse\GA20894-PA 294 GA20894-PA 9..289 41..353 476 37.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24836-PA 446 GM24836-PA 1..413 16..431 2110 99.3 Plus
Dsec\GM22318-PA 971 GM22318-PA 582..876 41..356 519 35.8 Plus
Dsec\GM23132-PA 314 GM23132-PA 13..287 41..350 484 36 Plus
Dsec\GM20132-PA 294 GM20132-PA 9..289 41..353 476 37.4 Plus
Dsec\GM11695-PA 297 GM11695-PA 9..288 41..351 462 34.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12888-PA 451 GD12888-PA 1..413 16..431 2110 99.3 Plus
Dsim\GD14906-PA 971 GD14906-PA 582..876 41..356 512 35.5 Plus
Dsim\GD19371-PA 314 GD19371-PA 13..287 41..350 484 36 Plus
Dsim\GD25609-PA 294 GD25609-PA 9..289 41..353 476 37.4 Plus
Dsim\GD24595-PA 353 GD24595-PA 18..311 42..370 463 34.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13608-PA 450 GJ13608-PA 1..416 16..431 2084 98.3 Plus
Dvir\GJ13763-PA 978 GJ13763-PA 588..882 41..356 497 36.4 Plus
Dvir\GJ21207-PA 294 GJ21207-PA 9..289 41..353 468 36.2 Plus
Dvir\GJ15416-PA 298 GJ15416-PA 9..288 41..351 458 34.3 Plus
Dvir\GJ20206-PA 388 GJ20206-PA 60..345 41..356 445 33.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12315-PA 460 GK12315-PA 1..428 16..438 2117 98.1 Plus
Dwil\GK21358-PA 389 GK21358-PA 58..342 41..355 486 33.5 Plus
Dwil\GK22466-PA 314 GK22466-PA 13..289 41..352 482 35.4 Plus
Dwil\GK21950-PA 294 GK21950-PA 9..289 41..353 476 37.2 Plus
Dwil\GK23499-PA 296 GK23499-PA 9..288 41..351 469 35.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20297-PA 450 GE20297-PA 1..412 16..431 2109 99 Plus
Dyak\GE19702-PA 949 GE19702-PA 560..854 41..356 511 35.5 Plus
Dyak\cdc2c-PA 314 GE25682-PA 13..287 41..350 479 35.7 Plus
Dyak\GE14145-PA 294 GE14145-PA 9..289 41..353 477 37.4 Plus
Dyak\GE26009-PA 297 GE26009-PA 9..288 41..351 462 34.3 Plus

FI03233.hyp Sequence

Translation from 1 to 1409

> FI03233.hyp
IFIYKQLWNLQTFVKMDYDFKMKTQIERTKVEDLFNYEGCKVGRGTYGHV
YKAKWKETSDGKEYALKQIDGTGLSMSACREIALLRELKHQNVITLIRVF
LSHNDRKVFLLIDYAEHDLWHIIKFHRAAKATKKQVVVPRGMVKSLLYQI
LDGIHYLHSNWVLHRDLKPANILVMGDGNERGRVKIADMGFARLFNAPLK
PLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFH
CRQEDIKTSNPYHHDQLDRIFNVMGFPQDKDWEDIKKMPEHHTLTKDFKR
STYSTCSLAKYMERHKIKPDSKAFHLLQKLLLMDPNKRITSEQAMQDQYF
QEEPQPTQDVFAGCPIPYPKREFLTDDDQEDKSDNKRQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQMNAEPNAKRVRLSGAGNQQDFHHQQQQQQQQQQQQ
QQQQQQMMFNQQQNFQRFN*

FI03233.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
Cdk8-PA 454 CG10572-PA 1..454 16..469 2423 100 Plus
Cdk2-PC 314 CG10498-PC 13..288 41..351 492 36.2 Plus
Cdk2-PB 314 CG10498-PB 13..288 41..351 492 36.2 Plus
Cdk2-PA 314 CG10498-PA 13..288 41..351 492 36.2 Plus
Pitslre-PG 778 CG4268-PG 389..683 41..356 489 35.5 Plus