Clone FI03247 Report

Search the DGRC for FI03247

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:32
Well:47
Vector:pFlc-1
Associated Gene/TranscriptCG13151-RA
Protein status:FI03247.pep: gold
Sequenced Size:1921

Clone Sequence Records

FI03247.complete Sequence

1921 bp assembled on 2009-07-08

GenBank Submission: BT088912.1

> FI03247.complete
ACGTTACTGTCCTAACCTATCGACGACTGAAAAGGTTTGTTTTGTTGCAA
GTTTATAAACAAACAATGGAATGCGTGCTGGACGAGGAGCTGCTGGCCAA
TATTAAATGTAGCGACCAGGAGGAAGAAGACGAGGATGGTGAAAAGATGG
AGGTGGAGGAGCGGCTGCCGCCGGTCGATTCCACAGTCCAAAGTGCCTCC
TTTAACGGAGATGACTCCGATCCGCTACAGGAAGCAGTATGCAATTTTCC
CTGGATTTTCGAGGACAGCGACATGCTGATGAACGAGGACCAACTGGCTG
ACGTGGTGCTGAAGAAGGAGGATTCCGCCAGGCCAGCTGCCCCGAAGCGA
GGACGTGGTCGTCCACCAAATAATAACGGAAACTACACATCTCCTTGTGG
GCAGCTATGGAGCGTGACCAGGAGCCCAGATATTTCTGCAGAGGATCTAC
CCCTTTTGGGGCAACAGGCCTGTGGCAAGGGACCCGCCCGAACAGTGTCC
AATGCAGTGGAAGCATGGATGCTGCTCTTCGATGATGAAATGCTGCGGTC
TTTACTTCGCCATATCAATGAACAGATGCGTAAGCGGAGAACGGCCACAA
GTGTCCAGAGACCCCTAGACGTTGTGGAGCTGCGGGCATTCTTGGGTCTA
AGCTACCTTTGTGGAGTGTTCCGAAATGCCAGGCACAATGGGCCATTGGA
TGAGCTGTGGACCCTGGAGCTGGGCAATGCCATATTCCGAGCATCCATGT
CGCTCGCTCGATTCGAAAGCATTTCCGAGTGTTTGGCGGGAAATTGCGGC
TGGTCCGAGGGCCAAAAGCTCTGGCAGCGCCTTATAATCAATTGCAGATC
CTACTACGGCTGCAGCAGTTGGTTGACCGTGGATGAGACATTCTGCGCGG
TGGCCAAGTCACGGATGACCCTCTGCTGTGATGCCAGGACACTGTACATG
GCCAATGCAGTGGTAAGCAGAAACCAGAGATGTCCGGACAAGGATGTAGA
ACAACTGATCTGCGATTTCAAGACCACGGGAAGAAATGTAACGCTGGGAT
CACGGTATCTAAACTTGACGCAGTGCGAGCAGTTGGCGCAGCGGCAAATA
AGCTCGTTGGGTAAGCTGGAGGCCAATTCGCCACATTGGCCGCGGCAGTG
GCCCACAGAATCACCCTTGTTTGGTGGCAGCTCAAAACTCATTCCGCTCG
ATGGCGACGCAGTCTTCTGCTGCGGTCTTAGCTCCCAAGTAGATGCAGTC
CAGGCATATGAGCAAACCTCAGAAGCCTGTCAGCAGTTTTACGAACACTC
CCAGCGCTTCAGCACAGCCCACGCTACGCCCGCACCCTTGAAAAAGCAGA
TCAATCCTTTTCTGCAACTACTTCACTTTGTGCTCAACGCGGCTGCCGTG
AATGCATGGATCCTGTTACGACTTTCGCCCAAAGGCGATGCCGCTATGGA
TCAGCGCGACTTCCAGAGACAGTTGGGACTCTTCCTCACACAGCAGAGAT
TACAGCGACGCCTTCAGCGAAGATCCACCAGCACTTCGCTCGTGATGCGA
CTGCAAATCTGCGAAATCCTGGGCCAATCCAGTCAGCGGCTGCTCAGTGA
GGCGACCGGCGAGGCGAAACTAACGCACAGCGTAGGCGTGCTAACACCCG
ACAAGATGAGCCTGCCCTTGGGCATTAATTTGGCTAGTCGGTACGGAGAG
AAGCATCGCAGGTGCAAGCCCTGCGCTCGAAATAAGCGTGGCACTAAATC
GCGGACGCGGTGCCAACAGTGCTTGCAACATCGATGCGGCAACCACTTGA
TATCCCGCTGCTACGAATGCGTCGGCATTTTGCCTGGCCAACTGCCCGAG
GGCAACATGGTGGATGAAGGAGCCACCTGAAGATGGATATTAAATAACAT
TTATGGAAAAAAAAAAAAAAA

FI03247.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG13151-RA 1906 CG13151-RA 1..1904 1..1904 9505 99.9 Plus
CG8818-RA 1718 CG8818-RA 1610..1718 1908..1800 530 99 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8402702..8404605 1..1904 9490 99.9 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13151-RA 1815 CG13151-PA 1..1815 66..1880 9060 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:47 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG13151-RA 1910 CG13151-RA 5..1908 1..1904 9505 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG13151-PA 604 CG13151-PA 1..604 66..1877 2824 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12515379..12517286 1..1908 9510 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12516578..12518485 1..1908 9510 99.8 Plus
Blast to na_te.dros performed 2014-11-27 05:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Tel 2485 Dvir\Tel 2485bp Derived from AF009439 (Rel. 66, Last updated, Version 3). 15..58 1490..1533 130 77.3 Plus

FI03247.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:41:56 Download gff for FI03247.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8402702..8404607 1..1906 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:49:52 Download gff for FI03247.complete
Subject Subject Range Query Range Percent Splice Strand
CG13151-RA 1..1815 66..1880 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:51:11 Download gff for FI03247.complete
Subject Subject Range Query Range Percent Splice Strand
CG13151-RA 1..1815 66..1880 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:25:51 Download gff for FI03247.complete
Subject Subject Range Query Range Percent Splice Strand
CG13151-RA 1..1815 66..1880 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:41:56 Download gff for FI03247.complete
Subject Subject Range Query Range Percent Splice Strand
CG13151-RA 1..1815 66..1880 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-08 15:54:19 Download gff for FI03247.complete
Subject Subject Range Query Range Percent Splice Strand
CG13151-RA 1..1906 1..1906 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:51:11 Download gff for FI03247.complete
Subject Subject Range Query Range Percent Splice Strand
CG13151-RA 1..1906 1..1906 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:25:51 Download gff for FI03247.complete
Subject Subject Range Query Range Percent Splice Strand
CG13151-RA 5..1910 1..1906 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:41:56 Download gff for FI03247.complete
Subject Subject Range Query Range Percent Splice Strand
CG13151-RA 5..1910 1..1906 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:41:56 Download gff for FI03247.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12515379..12517284 1..1906 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:25:51 Download gff for FI03247.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8402884..8404789 1..1906 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:27:14 Download gff for FI03247.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12516578..12518483 1..1906 99   Plus

FI03247.pep Sequence

Translation from 2 to 1879

> FI03247.pep
VTVLTYRRLKRFVLLQVYKQTMECVLDEELLANIKCSDQEEEDEDGEKME
VEERLPPVDSTVQSASFNGDDSDPLQEAVCNFPWIFEDSDMLMNEDQLAD
VVLKKEDSARPAAPKRGRGRPPNNNGNYTSPCGQLWSVTRSPDISAEDLP
LLGQQACGKGPARTVSNAVEAWMLLFDDEMLRSLLRHINEQMRKRRTATS
VQRPLDVVELRAFLGLSYLCGVFRNARHNGPLDELWTLELGNAIFRASMS
LARFESISECLAGNCGWSEGQKLWQRLIINCRSYYGCSSWLTVDETFCAV
AKSRMTLCCDARTLYMANAVVSRNQRCPDKDVEQLICDFKTTGRNVTLGS
RYLNLTQCEQLAQRQISSLGKLEANSPHWPRQWPTESPLFGGSSKLIPLD
GDAVFCCGLSSQVDAVQAYEQTSEACQQFYEHSQRFSTAHATPAPLKKQI
NPFLQLLHFVLNAAAVNAWILLRLSPKGDAAMDQRDFQRQLGLFLTQQRL
QRRLQRRSTSTSLVMRLQICEILGQSSQRLLSEATGEAKLTHSVGVLTPD
KMSLPLGINLASRYGEKHRRCKPCARNKRGTKSRTRCQQCLQHRCGNHLI
SRCYECVGILPGQLPEGNMVDEGAT*

FI03247.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12519-PA 596 GF12519-PA 1..594 22..616 2267 72.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20312-PA 604 GG20312-PA 1..604 22..625 2940 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21319-PA 593 GH21319-PA 8..592 22..621 1601 55.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13151-PA 604 CG13151-PA 1..604 22..625 3198 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19752-PA 600 GI19752-PA 10..599 25..621 1635 55.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10116-PA 597 GL10116-PA 1..593 22..621 1823 60.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12080-PA 597 GA12080-PA 1..593 22..621 1815 60.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21400-PA 604 GM21400-PA 1..604 22..625 2982 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10897-PA 530 GD10897-PA 1..530 22..551 2571 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18111-PA 590 GJ18111-PA 1..589 22..621 1551 55.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18971-PA 573 GK18971-PA 1..571 22..614 1484 51.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12472-PA 604 GE12472-PA 1..604 22..625 2898 93 Plus

FI03247.hyp Sequence

Translation from 2 to 1879

> FI03247.hyp
VTVLTYRRLKRFVLLQVYKQTMECVLDEELLANIKCSDQEEEDEDGEKME
VEERLPPVDSTVQSASFNGDDSDPLQEAVCNFPWIFEDSDMLMNEDQLAD
VVLKKEDSARPAAPKRGRGRPPNNNGNYTSPCGQLWSVTRSPDISAEDLP
LLGQQACGKGPARTVSNAVEAWMLLFDDEMLRSLLRHINEQMRKRRTATS
VQRPLDVVELRAFLGLSYLCGVFRNARHNGPLDELWTLELGNAIFRASMS
LARFESISECLAGNCGWSEGQKLWQRLIINCRSYYGCSSWLTVDETFCAV
AKSRMTLCCDARTLYMANAVVSRNQRCPDKDVEQLICDFKTTGRNVTLGS
RYLNLTQCEQLAQRQISSLGKLEANSPHWPRQWPTESPLFGGSSKLIPLD
GDAVFCCGLSSQVDAVQAYEQTSEACQQFYEHSQRFSTAHATPAPLKKQI
NPFLQLLHFVLNAAAVNAWILLRLSPKGDAAMDQRDFQRQLGLFLTQQRL
QRRLQRRSTSTSLVMRLQICEILGQSSQRLLSEATGEAKLTHSVGVLTPD
KMSLPLGINLASRYGEKHRRCKPCARNKRGTKSRTRCQQCLQHRCGNHLI
SRCYECVGILPGQLPEGNMVDEGAT*

FI03247.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13151-PA 604 CG13151-PA 1..604 22..625 3198 100 Plus