Clone FI03252 Report

Search the DGRC for FI03252

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:32
Well:52
Vector:pFlc-1
Associated Gene/Transcriptpav-RA
Protein status:FI03252.pep: gold
Sequenced Size:3222

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
pav 2008-12-18 5.12 accounting

Clone Sequence Records

FI03252.complete Sequence

3222 bp assembled on 2008-12-05

GenBank Submission: BT053676.1

> FI03252.complete
GGTCACTCTAAAACCAAGCGTGGCGTCGCTTGGCGCTGTAAATTTGAAGG
TAACGAACTAAAAGAGAGATCGATTCCAGCAACAAAACAAGAAGAAACCC
AACTCCCGTATATCAAATTAGTTGCAAAAACGAGCTGACAACATGAAGGC
AGTACCCAGGACGCCGATGCGTGTCGTCCCGAAAACTCCGCGGGTGCATC
AAACGGTGGAGAAACAGCGACGAGACACCTCCGACAAGGCCAGGGATCCA
GTGAATGTGTTCTGTCGAGTGCGGCCACTACAATCCGACGCAGATCTCAC
CTCCCTAAGGGTCAAGAACTCCACGACGATCGCACTGAATCCGCAGGATC
AGCTGCTGCAGCATCACAAGCCACACAACGGCGCCCAGCGCGAGGTTCAG
TACATATTCAAGCACGTTTTCCAGCCGGATGCCACGCAGCAGGATGTGTA
CGCAGCTGTGGCCCAGCCGTTGGTGGAGAACCTACTGAAAGGCCGAAACA
GTCTGCTTTTCACCTACGGCGTGACTGGAAGTGGAAAAACGTACACCATG
ACCGGCAACCTGCGACACCGCGGCATCATGCCGCGCTGCCTGGACGTGCT
CTTTCGCACCATTTCAGATTACCAGGCCAAGAAGTTCGTCTTCAAGCCGG
ACAAGCTTAATGGCTTCGAGATCCTGTCCGAAGAGGATGCGCTTTTGGAG
CGCCAACACGAGATGAACCAGCGTTTTGCTGGCTCAGGACGATTTGCCTT
CAGGCACAAGGACTCGGATCCGGAAATTGCATCCCAGGCCTCCGTGGAGC
CAATTCCGCTGCTGGGTTTGGATGAGGACAACATGTACTCGGTGTTTGTC
ACCTATATTGAAATTTACAATAACAGCGTCTACGACCTCCTTGAGGACTC
GGGTATACAGAAGACTTTGCAGAGCAAAATCATTCGTGAAGATGCCAATC
GACACATGTTCGTCCACGGCGTCACAGAGGTGGAGGTCAAGACCGTGGAG
GACGCCCTCGAGGTCTTTCAAATGGGCCAGAAGCGCAAACGAATGGGACA
CACTGTTCTCAATGCAGAATCCAGTAGGAGTCACTCGGTGTTCAATATAC
GCTTGGTGCAGGCGCCCACTGATAGCCAGGGTGAGAATGTGGTTCAGGAC
CGGCAAAACATCACAGTGAGTCAACTGTCCCTGGTGGATCTGGCGGGCAG
TGAGCGATCCTCAAGGACCAAGAACACCGGTGTGCGACTCCGTGAGGCGG
GCAACATCAATAATTCGCTGATGACGCTGCGCACTTGCCTGGAATATCTG
CGCGAGAACCAACTCGCGGCTAGCAATGGATTGGCACCCAAGAAGGTCCC
CTATCGAGACTCCAAGATCACACACATGTTTAAAAACTACTTCGATGGCG
AAGGCCAGGTGTCCATGATTGTGTGCATCAACCCAAGAATTGAGGACTAT
GATGAGAATATGCAAGTGATGAAGTTCGCCGAGATGACCCAGGAGGTGCA
AATTGCTCGGGCGACTCCTATGAAGCAAGATTTGGGTCTGACTCCCGGCC
GTCGCAAGGCCAACAAGCTGTTCAAGATTGCCGTTAATAATCTAAACGAG
CTGGGCATTCCTGAGGCCAAGGATTTGGAGGTGGACGTGGGTTTGGTGTA
CAGTTTGGGACCCGATTTTCCCGCCTACGAAATGGACAGTCCCGAGGCAC
AGATCAAAATCCGCGAGCTAATGCATTATCTGGAGCAGCGCATAGAAAAG
CGAAAGAAGCTGCGTGCCAACTTGGACATTAAATGTGACAGCTTCCGGCA
GATGCTGATGAACCTTGACCGCGACAATCTTCAGCTGCGCACGGAGCTCG
CCTCCTTAAAGGCTGTTTACAAGCAGGAGCGCGATCGCAGTGCGGCACTC
GAGAAGAAGGTTCGCATCCACGAGAGCTCCATTGACGTGCTTAACAATAC
GCTAAGCAAGCAAGAACGGCAGATTGAAGAGCTGACTTTCAAGCTGAACG
AGAAGGAGAATATGCTCACCCAAAAGGAGCACGAGAAGGAAAAGCAAAAG
AAGAAGTTCAGCTCCAAGCTGGCCGTTGAGTCGGACAAAAATAAGCGAGA
GTTTGAACTAAAGCTGCGTGAACAGCGAGTGAAATTGCAGGAACGCATGC
GCATCAAGGACGAGAAGTTGCGATTGGTCTCCAACATTCTGCAGTCCGAA
GATCTGCCCAGTTTGCCGCGGTCACAGAGCTCGGAAAACATACTTAATGA
GAAAGATCGCGGTGCATATACGGCGCGCACGGAGGAGTCCTCGGTGCCAG
CTACACGAACAGATATATATGCAACGCCACGTCATGGTGCAGCAGCGGCC
AACAATCGGCATAGACGCTCTCGATCCGCAGGCGACAAGTGGCTGGAGCA
TCGGGCAGCTAATCCCGTTCCGCTTGGCACTATTATGCAGCCGTATCTGA
AGAATCGCAAATCCGTAACGAAACTAACCGACTTGAAGGAGTTGACTGCT
CACGGAACTACGAAGTACTGTCTCGTCTCGCAGGATGCGGATACGGATGG
CGATGTGGAGACGAAGCTGTATAAGGGCAATGTAATTCCCACTTGTGGCG
GTGGTGCCCAAGTTGTGTTCAACGATGTGGAGTGCCTCAAGCAGAAGTCA
CCGGTTCACTCGCCCACGCGAAAGCGACCCAGCAATGGCAACATTTCGGC
TCTGGGCGGCGGTGCAGTGCCCAGCACGGTCACCTCAGCCCAGGACGTAG
CCTCCCGCTGCAATCTCGGCATTGAGGGACACAGCAGCAAGAAGTCGAAA
ATCTAAAAATGACTCAGCGTGGAATTCTCAAAGTCAATTACCCATTTAGT
TCATAGTTACTTAGTTTCCATAACTTAAATTTAAGTTTATTACTCACCCA
CTTCGGTTTTTGGAGTTGAATCGCATTGAAGTGATTTGTTTGATTAAAGA
AAAGTTAATCTGTATAAATAATCCCGTAAATGAATTCGCAACCCCTCGCA
AATGGAAATGTTTCCTGCTCCAAATAGTCGGTACCCGGAGGGTATCTGCC
AAGAGCAGTTGTTAGAAACTATCCAAGCATCGTCCAATCATAGAACTACT
CTAGTGTTATTATAAAGTATTAAATATTTTATTGTTTTTCGGAGTGAACC
CAACTCCAGTCCAGTCACAAAATGAACAAATAAAGTGAATTACGCGCATA
TACTGAAAAAAAAAAAAAAAAA

FI03252.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
pav-RA 3270 pav-RA 31..3238 1..3208 16040 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:47:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4244750..4245619 2336..3205 4350 100 Plus
chr3L 24539361 chr3L 4242334..4243093 154..913 3800 100 Plus
chr3L 24539361 chr3L 4244138..4244689 1785..2336 2760 100 Plus
chr3L 24539361 chr3L 4243151..4243700 913..1462 2750 100 Plus
chr3L 24539361 chr3L 4243760..4244084 1462..1786 1625 100 Plus
chr3L 24539361 chr3L 4242122..4242274 1..153 765 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
pav-RA 2664 CG1258-PA 1..2664 143..2806 13320 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:09:50 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
pav-RA 3207 CG1258-RA 3..3207 1..3205 16025 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
pav-PA 887 CG1258-PA 1..880 143..2782 4311 100 Plus
sub-PB 628 CG12298-PB 80..479 224..1498 429 30.5 Plus
sub-PA 628 CG12298-PA 80..479 224..1498 429 30.5 Plus
Klp31E-PE 1047 CG5300-PE 14..364 251..1501 388 28.5 Plus
Klp31E-PC 1048 CG5300-PC 14..364 251..1501 388 28.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4245364..4246236 2336..3208 4365 100 Plus
3L 28110227 3L 4242948..4243707 154..913 3800 100 Plus
3L 28110227 3L 4244752..4245303 1785..2336 2760 100 Plus
3L 28110227 3L 4243765..4244314 913..1462 2750 100 Plus
3L 28110227 3L 4244374..4244698 1462..1786 1625 100 Plus
3L 28110227 3L 4242736..4242888 1..153 765 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4245364..4246236 2336..3208 4365 100 Plus
3L 28103327 3L 4242948..4243707 154..913 3800 100 Plus
3L 28103327 3L 4244752..4245303 1785..2336 2760 100 Plus
3L 28103327 3L 4243765..4244314 913..1462 2750 100 Plus
3L 28103327 3L 4244374..4244698 1462..1786 1625 100 Plus
3L 28103327 3L 4242736..4242888 1..153 765 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:47:01 has no hits.

FI03252.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:59:55 Download gff for FI03252.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4244750..4245619 2336..3205 100   Plus
chr3L 4244138..4244688 1785..2335 100 -> Plus
chr3L 4243761..4244082 1463..1784 100 -> Plus
chr3L 4243151..4243700 913..1462 100 -> Plus
chr3L 4242334..4243092 154..912 100 -> Plus
chr3L 4242122..4242274 1..153 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:43:19 Download gff for FI03252.complete
Subject Subject Range Query Range Percent Splice Strand
pav-RA 1..2664 143..2806 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:20:53 Download gff for FI03252.complete
Subject Subject Range Query Range Percent Splice Strand
pav-RA 1..2664 143..2806 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:15:49 Download gff for FI03252.complete
Subject Subject Range Query Range Percent Splice Strand
pav-RA 1..2664 143..2806 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:59:55 Download gff for FI03252.complete
Subject Subject Range Query Range Percent Splice Strand
pav-RA 1..2664 143..2806 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-05 09:40:06 Download gff for FI03252.complete
Subject Subject Range Query Range Percent Splice Strand
pav-RA 1..3205 1..3205 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:20:53 Download gff for FI03252.complete
Subject Subject Range Query Range Percent Splice Strand
pav-RA 1..3205 1..3205 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:15:49 Download gff for FI03252.complete
Subject Subject Range Query Range Percent Splice Strand
pav-RA 3..3207 1..3205 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:59:55 Download gff for FI03252.complete
Subject Subject Range Query Range Percent Splice Strand
pav-RA 3..3207 1..3205 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:59:55 Download gff for FI03252.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4245364..4246233 2336..3205 100   Plus
3L 4244752..4245302 1785..2335 100 -> Plus
3L 4244375..4244696 1463..1784 100 -> Plus
3L 4243765..4244314 913..1462 100 -> Plus
3L 4242948..4243706 154..912 100 -> Plus
3L 4242736..4242888 1..153 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:15:49 Download gff for FI03252.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4245364..4246233 2336..3205 100   Plus
arm_3L 4244752..4245302 1785..2335 100 -> Plus
arm_3L 4244375..4244696 1463..1784 100 -> Plus
arm_3L 4243765..4244314 913..1462 100 -> Plus
arm_3L 4242948..4243706 154..912 100 -> Plus
arm_3L 4242736..4242888 1..153 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:52:26 Download gff for FI03252.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4245364..4246233 2336..3205 100   Plus
3L 4244752..4245302 1785..2335 100 -> Plus
3L 4244375..4244696 1463..1784 100 -> Plus
3L 4243765..4244314 913..1462 100 -> Plus
3L 4242948..4243706 154..912 100 -> Plus
3L 4242736..4242888 1..153 100 -> Plus

FI03252.pep Sequence

Translation from 142 to 2805

> FI03252.pep
MKAVPRTPMRVVPKTPRVHQTVEKQRRDTSDKARDPVNVFCRVRPLQSDA
DLTSLRVKNSTTIALNPQDQLLQHHKPHNGAQREVQYIFKHVFQPDATQQ
DVYAAVAQPLVENLLKGRNSLLFTYGVTGSGKTYTMTGNLRHRGIMPRCL
DVLFRTISDYQAKKFVFKPDKLNGFEILSEEDALLERQHEMNQRFAGSGR
FAFRHKDSDPEIASQASVEPIPLLGLDEDNMYSVFVTYIEIYNNSVYDLL
EDSGIQKTLQSKIIREDANRHMFVHGVTEVEVKTVEDALEVFQMGQKRKR
MGHTVLNAESSRSHSVFNIRLVQAPTDSQGENVVQDRQNITVSQLSLVDL
AGSERSSRTKNTGVRLREAGNINNSLMTLRTCLEYLRENQLAASNGLAPK
KVPYRDSKITHMFKNYFDGEGQVSMIVCINPRIEDYDENMQVMKFAEMTQ
EVQIARATPMKQDLGLTPGRRKANKLFKIAVNNLNELGIPEAKDLEVDVG
LVYSLGPDFPAYEMDSPEAQIKIRELMHYLEQRIEKRKKLRANLDIKCDS
FRQMLMNLDRDNLQLRTELASLKAVYKQERDRSAALEKKVRIHESSIDVL
NNTLSKQERQIEELTFKLNEKENMLTQKEHEKEKQKKKFSSKLAVESDKN
KREFELKLREQRVKLQERMRIKDEKLRLVSNILQSEDLPSLPRSQSSENI
LNEKDRGAYTARTEESSVPATRTDIYATPRHGAAAANNRHRRSRSAGDKW
LEHRAANPVPLGTIMQPYLKNRKSVTKLTDLKELTAHGTTKYCLVSQDAD
TDGDVETKLYKGNVIPTCGGGAQVVFNDVECLKQKSPVHSPTRKRPSNGN
ISALGGGAVPSTVTSAQDVASRCNLGIEGHSSKKSKI*

FI03252.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10567-PA 887 GF10567-PA 1..887 1..887 4360 92.4 Plus
Dana\GF13227-PA 621 GF13227-PA 74..473 28..452 449 30.8 Plus
Dana\GF11865-PA 1903 GF11865-PA 140..352 231..452 348 36.9 Plus
Dana\GF13317-PA 660 GF13317-PA 229..548 67..459 305 26.5 Plus
Dana\GF23742-PA 805 GF23742-PA 152..355 232..464 299 32.8 Plus
Dana\GF11865-PA 1903 GF11865-PA 2..142 33..168 179 29 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\pav-PA 887 GG15209-PA 1..887 1..887 4619 98 Plus
Dere\GG21022-PA 628 GG21022-PA 80..479 28..452 454 30.2 Plus
Dere\GG10128-PA 1048 GG10128-PA 14..357 37..446 408 28.6 Plus
Dere\GG12607-PA 1214 GG12607-PA 9..329 37..447 355 27.9 Plus
Dere\GG22349-PA 1913 GG22349-PA 140..352 231..452 346 36.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15541-PA 895 GH15541-PA 10..895 6..887 4018 85.8 Plus
Dgri\GH19853-PA 605 GH19853-PA 80..469 39..452 442 29.4 Plus
Dgri\GH13544-PA 1050 GH13544-PA 14..352 37..446 380 29.3 Plus
Dgri\GH21646-PA 1913 GH21646-PA 140..352 231..452 342 36.5 Plus
Dgri\GH13658-PA 1111 GH13658-PA 198..510 97..446 306 29.5 Plus
Dgri\GH21646-PA 1913 GH21646-PA 2..142 33..168 181 28.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
pav-PA 887 CG1258-PA 1..887 1..887 4528 100 Plus
sub-PB 628 CG12298-PB 80..479 28..452 429 30.5 Plus
sub-PA 628 CG12298-PA 80..479 28..452 429 30.5 Plus
Klp31E-PE 1047 CG5300-PE 14..561 37..703 390 25.4 Plus
Klp31E-PC 1048 CG5300-PC 14..559 37..688 390 25.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16586-PA 892 GI16586-PA 1..892 1..887 3987 85 Plus
Dmoj\GI20445-PA 604 GI20445-PA 79..468 39..452 439 29.6 Plus
Dmoj\GI20099-PA 1910 GI20099-PA 140..352 231..452 351 36.9 Plus
Dmoj\GI18489-PA 1778 GI18489-PA 136..351 228..452 302 33.8 Plus
Dmoj\GI10718-PA 702 GI10718-PA 352..682 34..457 298 26 Plus
Dmoj\GI20099-PA 1910 GI20099-PA 2..142 33..168 177 29 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12840-PA 887 GL12840-PA 1..887 1..887 4228 89.6 Plus
Dper\GL21444-PA 898 GL21444-PA 1..898 1..887 4004 84.3 Plus
Dper\GL13777-PA 788 GL13777-PA 1..728 1..731 3429 89.1 Plus
Dper\GL19751-PA 159 GL19751-PA 1..159 732..887 743 86.8 Plus
Dper\GL17361-PA 620 GL17361-PA 83..472 39..452 413 29.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11700-PA 887 GA11700-PA 1..887 1..887 4232 89.7 Plus
Dpse\GA24227-PA 620 GA24227-PA 83..472 39..452 406 29.2 Plus
Dpse\GA22117-PB 750 GA22117-PB 70..373 83..452 361 30.1 Plus
Dpse\GA20876-PB 1904 GA20876-PB 140..352 231..452 350 36.9 Plus
Dpse\GA20876-PA 1918 GA20876-PA 140..352 231..452 350 36.9 Plus
Dpse\GA20876-PB 1904 GA20876-PB 2..142 33..168 193 29.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14638-PA 887 GM14638-PA 1..887 1..887 4726 99 Plus
Dsec\GM19953-PA 628 GM19953-PA 80..479 28..452 456 30.7 Plus
Dsec\GM18350-PA 1046 GM18350-PA 14..357 37..446 385 29.9 Plus
Dsec\GM12219-PA 705 GM12219-PA 341..680 24..457 338 26.1 Plus
Dsec\GM24884-PA 808 GM24884-PA 151..354 232..464 297 32.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:00:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\pav-PA 928 GD13826-PA 1..928 1..887 4625 95.2 Plus
Dsim\GD25444-PA 628 GD25444-PA 80..479 28..452 456 30.7 Plus
Dsim\GD23697-PA 1048 GD23697-PA 14..357 37..446 400 30 Plus
Dsim\GD25614-PA 1913 GD25614-PA 140..352 231..452 346 36.5 Plus
Dsim\GD11742-PA 732 GD11742-PA 219..567 7..452 324 26.4 Plus
Dsim\GD25614-PA 1913 GD25614-PA 2..142 33..168 195 30.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:00:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12838-PA 891 GJ12838-PA 1..891 1..887 4015 85.1 Plus
Dvir\GJ20115-PA 606 GJ20115-PA 80..470 39..452 434 29.7 Plus
Dvir\GJ21851-PA 1105 GJ21851-PA 14..352 37..446 392 29.9 Plus
Dvir\GJ16941-PA 1203 GJ16941-PA 3..326 35..447 363 27.9 Plus
Dvir\GJ16505-PA 1175 GJ16505-PA 3..326 35..447 362 27.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:00:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10551-PA 887 GK10551-PA 1..886 1..886 3946 84.2 Plus
Dwil\GK17824-PA 617 GK17824-PA 1..557 1..597 1701 58.6 Plus
Dwil\GK16261-PA 609 GK16261-PA 83..470 39..452 464 31.9 Plus
Dwil\GK10187-PA 1198 GK10187-PA 23..353 30..447 367 27.3 Plus
Dwil\GK10908-PA 750 GK10908-PA 41..376 39..452 364 29.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:00:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\pav-PA 887 GE21428-PA 1..887 1..887 4710 98.1 Plus
Dyak\GE13965-PA 630 GE13965-PA 83..482 28..452 444 30 Plus
Dyak\GE18940-PA 1047 GE18940-PA 13..356 37..446 394 29 Plus
Dyak\GE10426-PA 701 GE10426-PA 337..676 24..457 348 26.7 Plus
Dyak\GE14150-PA 1912 GE14150-PA 140..352 231..452 346 36.5 Plus

FI03252.hyp Sequence

Translation from 142 to 2805

> FI03252.hyp
MKAVPRTPMRVVPKTPRVHQTVEKQRRDTSDKARDPVNVFCRVRPLQSDA
DLTSLRVKNSTTIALNPQDQLLQHHKPHNGAQREVQYIFKHVFQPDATQQ
DVYAAVAQPLVENLLKGRNSLLFTYGVTGSGKTYTMTGNLRHRGIMPRCL
DVLFRTISDYQAKKFVFKPDKLNGFEILSEEDALLERQHEMNQRFAGSGR
FAFRHKDSDPEIASQASVEPIPLLGLDEDNMYSVFVTYIEIYNNSVYDLL
EDSGIQKTLQSKIIREDANRHMFVHGVTEVEVKTVEDALEVFQMGQKRKR
MGHTVLNAESSRSHSVFNIRLVQAPTDSQGENVVQDRQNITVSQLSLVDL
AGSERSSRTKNTGVRLREAGNINNSLMTLRTCLEYLRENQLAASNGLAPK
KVPYRDSKITHMFKNYFDGEGQVSMIVCINPRIEDYDENMQVMKFAEMTQ
EVQIARATPMKQDLGLTPGRRKANKLFKIAVNNLNELGIPEAKDLEVDVG
LVYSLGPDFPAYEMDSPEAQIKIRELMHYLEQRIEKRKKLRANLDIKCDS
FRQMLMNLDRDNLQLRTELASLKAVYKQERDRSAALEKKVRIHESSIDVL
NNTLSKQERQIEELTFKLNEKENMLTQKEHEKEKQKKKFSSKLAVESDKN
KREFELKLREQRVKLQERMRIKDEKLRLVSNILQSEDLPSLPRSQSSENI
LNEKDRGAYTARTEESSVPATRTDIYATPRHGAAAANNRHRRSRSAGDKW
LEHRAANPVPLGTIMQPYLKNRKSVTKLTDLKELTAHGTTKYCLVSQDAD
TDGDVETKLYKGNVIPTCGGGAQVVFNDVECLKQKSPVHSPTRKRPSNGN
ISALGGGAVPSTVTSAQDVASRCNLGIEGHSSKKSKI*

FI03252.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
pav-PA 887 CG1258-PA 1..887 1..887 4528 100 Plus
sub-PB 628 CG12298-PB 80..479 28..452 429 30.5 Plus
sub-PA 628 CG12298-PA 80..479 28..452 429 30.5 Plus
Klp31E-PE 1047 CG5300-PE 14..561 37..703 390 25.4 Plus
Klp31E-PC 1048 CG5300-PC 14..559 37..688 390 25.1 Plus