Clone FI03279 Report

Search the DGRC for FI03279

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:32
Well:79
Vector:pFlc-1
Associated Gene/TranscriptCG5830-RA
Protein status:FI03279.pep: gold
Sequenced Size:3548

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5830 2008-12-18 5.12 accounting

Clone Sequence Records

FI03279.complete Sequence

3548 bp assembled on 2008-10-27

GenBank Submission: BT050447.1

> FI03279.complete
AAACGTTTTGTTTTTTGCGCTATTCCTGTTACTTTTTTTCGACGTACACA
CGCGTTTTGTTATTTTGCGCGATTAATTAATGGCAAAAAATAAAAAAAAT
AAATAAATAACGAGACGAAATAACGAAAACACCAGCGGCCGAGCTAGTGT
GCGTGCGAGAGTGTGTGTGAGTGCTGTGTCTGTGTGGGCGTTTATAAATA
AAACGCTGCGAAGCTGTGTGCGAAAAGCAGACGCGGATAAAGAAGTAAAA
GAATGAGCGCAACCAAAAACAAGAGCGAAGGAAAGAAAGAAAGTGTTTTT
TATTGAAATTCGTTGAAAAGTTTTAAATTTACTAAAACAGAGAGGCGAAA
GTGCAACAGAGCGAAAGAGAGAGCGATAAATAGCGAGCTATCCTATACGA
AACCGATCTGAATCAGTATCTGAATCCGAATCCGATTTATCAACCTGTTA
AGCGAAGTGGAGCCACAAACCGAGTGCTTAAATGGATGCAACATCAATAA
TAACGCAAGTTTCCCGCGACGACGAGCAACTGAACGTCTATCCCAGCTAT
CCCAATGACAAAGACGATGTGGATCGTTTAAAGCCACAGAAGCGAGGATT
ATTCCATTCTCTGCTTTGCTGCTGGCGACGAAACCGAACGAAAACCAACC
AGAATGGCACACAAATCGATGGATCGACAACACCGCCACCATTACCGGAC
CAACAAAGGTACCTACTACCTCAGGTTAGGCTTACCGATATGCACAGAAA
GTGCATGGTGATCGATTTGGATGAGACCCTAGTGCACAGTAGTTTTAAGC
CCATACCGAATGCTGATTTCATAGTGCCCGTGGAGATCGATGGAACCGTA
CATCAGGTGTACGTCCTGAAGCGACCGCACGTGGACGAGTTTCTGCAGAA
GATGGGCGAACTATACGAGTGCGTTCTGTTCACAGCATCACTAGCCAAAT
ACGCAGATCCCGTCGCCGATCTGTTAGACAAGTGGAATGTGTTTCGTGCA
AGACTGTTTAGGGAATCATGCGTTTATTACAGGGGTAATTACATTAAGGA
TCTGAATCGTCTGGGGCGGGACCTTCAGAAGATTGTCATTGTCGACAATT
CACCGGCCAGTTATATCTTTCATCCAGACAATGCAGTTCCTGTTAAATCC
TGGTTTGACGATGTCACCGACTGCGAACTGCGCGAACTGATCCCGCTCTT
TGAGAAGCTTAGCAAAGTTGATTCCGTCTACTCGGTGCTCTGCAATTCGA
ACCAGCCGCTGAACAATCAGACAAACCAGCAGCAGCATCCCCAGGAACTG
CAGCAGGCGCCGAACCAGCTGCATCAGCAGCTCCAACAGCAGCAACAACA
ACAGACCATCTCTGCCACGACAGTTATTACCCAGGCAACCACATTGTCTG
CTCCGACCATGTTGAACCAGCAGCAGACAAGTCCGCCCAGCCCACAAAGC
GAGTTGCTGCAAAAGACGTAACATCAGTGGGAACTAATGTTTATAAATAT
GTGATAAATTGTTTACATATTACAAGACCAAGCAAGCCGATAAGCAAGCA
AACAAAGCATCCCTATCCCAAGCAGTTCACTCAGTACCCCAGGACGAATG
GTAATGGGTCGACGAGATGAAATCAACTACCAATTGCTATCAACTATAAT
CCCCAGATCGACACCTAGGCCTAAGCATAAGTTTTATATGATATACATAA
TTTTTACAGAACCCAATTTACACGGCACATTTGTTATTTATTCTTGTTTT
GCTCTAAACCAATTATAATAATTATTATTTTTTTGTGTTTTTTCTAAACA
ACTGCTTATTGCTTACTGCGTTTTGCGGTACCCCAACTAGGGGGTATATT
AAATCCAAGCATAAGCCTCTATTTTTACCCAATAATCATAACTCTGTAGA
CGTATTTAATGGTAAACCAATTGAGCAAGCAAAAGATTTAAATGCATAAA
ACAAAAATGATAACTATACATATGAACAGAGAGATAAAATCAAATTCAAA
ATAGCTATATTTATATATATTTTTTATTAAAAAAACAAGAAAACAAAAAG
AAATATGAGTAAATGTGGAGAAGAAAAAATGAAAAGAAAAGAGAAAACTA
AAAACAATATATATAATACGTGTACTAAAACAAATTTATATATACATACA
TACATGGATATATATATATATATATTTAAGGCATGTGTCTACACATGTTT
CTAGCACTTAGGCATGTATAATATTTCGTATATTTATTAAAGAATTAAGT
TTAAGCGCGGTCTCCCACTCACGCTTGATCGCTGGCACTGGCAAATGTCA
TAGTTGGTATATCGGGTTTGTCGCATAAATGGCTTCATCGTATCACATTC
TGGTTTCCTGAAATGTCTCTCAGTCGTGAGTGGGATTGGGCCGCGCTTAA
AGCAGCCAAGTTGCATTGCAAGAGGGTGAAAATGGGCTATCTGTAAGCCA
CTTTGTAAAGCATCTAAAAGTCTGCGGCGCGTCCGTAGTTATAATATATA
AAGATTCGCTTATTCTGCGCTTATCGATGGTCCAAAGTCGGCAGGTTCCA
TTCGACCCTATTCTGTACACACATTCAGTCCAATCTGGTATTACGATTAG
CCCACTGTCCTAGCGCAAATTCTAATTGCCGGTCTTTGGAAACTCGGCCA
GGCGCAGTCGTAAAACATTGTATTAGGCTTAATGAAAAATTATACATCTA
AATATTTTAACCGATTTACGTTAATTTCCCCCTATTATCAAGTGCGCTTA
TGAAACGCATTGCAATATATATATATATATATATTTACGTCTAATTTAAC
CCTTCTTCGACATGAACTTCACCTTCGGCCGCGTTCTGTATTCTGTGTTG
TGCATGTGAAAATGGGAAACGAATGTAAACGATGAAACACCTATAGCTTC
TTTCAACTCCGACCAAATATCAATCATTATATAGTATATATATATACTGA
GCTCAAGCTGGCCACGCCGAAATCCCACCTGATAAATATATTATATAGAC
AAAAGACGCTATTGCTATCCGAAACACATACACGATTCGCTCACAGACCA
GTCCAGACAGAACTCTTTTTATCTTTTCTCTATGTGTAATCAATGTCTTG
TATTTCTCAACTAACTTTTGCAACCATTCTTTTATTTAGTGCATAAGCCA
TTGTGTTTCTAATTTGCTTAGACTAAAAATAATAATATTGAAAGGATACA
AAAATTGGCACGTTGCAAACGCGCGCGATATTCTCATATTTTTTGCAATC
AAGCAAGTAAATTATACATAATGCTAAAATAATATATGTATTGTATATCA
TTTACACCCGCTGCAAAAGTCTAAGGCAAATGCTAAAAATTAATTGCAAC
TAATCACGAAATTTAAATAGCAGTAAATCGCAAGAACTCGTTTAAATTTC
CTACTTTTAAATGTTTTACTTTTTGTAAAAGCAAAACGAAAACCAATCGA
TAAACCATTCACTTAATTTATCATAAAAGGGAAGAAATTCTATTTTTTAA
AGTGAGCCTATTAATGTAATGCATCAATGTCGAAAAAAAAAAAAAAAA

FI03279.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5830-RA 3560 CG5830-RA 3..3549 3..3548 17650 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15982472..15984868 3532..1136 11575 99.3 Minus
chr3L 24539361 chr3L 15994155..15994538 387..3 1860 99.5 Minus
chr3L 24539361 chr3L 15985411..15985648 799..562 1190 100 Minus
chr3L 24539361 chr3L 15985156..15985342 984..798 935 100 Minus
chr3L 24539361 chr3L 15993705..15993882 563..386 890 100 Minus
chr3L 24539361 chr3L 15984934..15985089 1137..982 780 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG5830-RA 990 CG5830-PA 1..990 482..1471 4950 100 Plus
CG5830-RB 1059 CG5830-PB 152..1059 564..1471 4540 100 Plus
CG5830-RB 1059 CG5830-PB 1..85 482..566 425 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG5830-RA 3534 CG5830-RA 4..3534 3..3532 17590 99.9 Plus
CG5830-RB 3603 CG5830-RB 634..3603 564..3532 14785 99.9 Plus
CG5830-RB 3603 CG5830-RB 4..567 3..566 2820 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG5830-PA 329 CG5830-PA 1..254 482..1243 1357 100 Plus
CG5830-PB 352 CG5830-PB 1..277 482..1243 1323 91.7 Plus
Dd-PB 240 CG1696-PB 51..230 728..1240 358 43.3 Plus
Dd-PA 243 CG1696-PA 54..233 728..1240 358 43.3 Plus
CG8584-PA 293 CG8584-PA 89..275 728..1240 286 37.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15992653..15995066 3548..1136 11975 99.8 Minus
3L 28110227 3L 16004349..16004733 387..3 1925 100 Minus
3L 28110227 3L 15995610..15995847 799..562 1190 100 Minus
3L 28110227 3L 15995355..15995541 984..798 935 100 Minus
3L 28110227 3L 16003899..16004076 563..386 890 100 Minus
3L 28110227 3L 15995133..15995288 1137..982 780 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:29:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15985753..15988166 3548..1136 11985 99.8 Minus
3L 28103327 3L 15997449..15997833 387..3 1925 100 Minus
3L 28103327 3L 15988710..15988947 799..562 1190 100 Minus
3L 28103327 3L 15988455..15988641 984..798 935 100 Minus
3L 28103327 3L 15996999..15997176 563..386 890 100 Minus
3L 28103327 3L 15988233..15988388 1137..982 780 100 Minus
Blast to na_te.dros performed 2014-11-27 03:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1059..1181 1251..1378 231 69 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6769..6918 1249..1393 224 64 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6879 1263..1425 222 62.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6784..6907 1249..1373 217 64.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2321..2471 1273..1430 216 62.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6832 1249..1354 215 67 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2326..2507 1251..1426 210 62 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6748..6850 1249..1354 208 67.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6841..6923 1271..1352 205 73.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2422 1277..1393 204 65 Plus
roo 9092 roo DM_ROO 9092bp 1057..1152 1276..1372 194 70.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2447..2659 1271..1476 173 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1517..1627 1276..1384 171 64 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2372..2476 1249..1353 165 61.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6714..6844 1296..1430 159 61.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1497..1702 1271..1484 157 57.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6874 1314..1477 157 61.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2721..2833 1251..1361 155 64.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2590..2665 1275..1353 154 68.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2818..2922 1251..1352 149 61.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2374 1279..1353 145 70.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2748..2851 1292..1393 145 62.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2893..2986 1259..1353 139 62.1 Plus
roo 9092 roo DM_ROO 9092bp 1049..1140 1305..1393 136 65.2 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3285..3322 1316..1353 136 84.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2363 1301..1354 135 72.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6799 1296..1373 135 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1517..1595 1315..1393 133 67.9 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 967..1010 1311..1354 130 77.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2348 1312..1354 125 76.7 Plus
412 7567 412 412 7567bp 4085..4165 3145..3067 121 63 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1555..1594 1275..1314 119 77.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2341 1318..1353 117 80.6 Plus

FI03279.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:40:50 Download gff for FI03279.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15994155..15994540 1..387 92   Minus
chr3L 15993705..15993880 388..563 100 <- Minus
chr3L 15985411..15985646 564..799 100 <- Minus
chr3L 15985159..15985340 800..981 100 <- Minus
chr3L 15984936..15985089 982..1135 100 <- Minus
chr3L 15984728..15984868 1136..1276 100 <- Minus
chr3L 15983999..15984649 1355..2005 95 == Minus
chr3L 15982472..15983896 2108..3532 95 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:40:43 Download gff for FI03279.complete
Subject Subject Range Query Range Percent Splice Strand
CG5830-RA 1..990 482..1471 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:17:14 Download gff for FI03279.complete
Subject Subject Range Query Range Percent Splice Strand
CG5830-RA 1..990 482..1471 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:41:46 Download gff for FI03279.complete
Subject Subject Range Query Range Percent Splice Strand
CG5830-RA 1..990 482..1471 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:40:50 Download gff for FI03279.complete
Subject Subject Range Query Range Percent Splice Strand
CG5830-RA 1..990 482..1471 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:40:42 Download gff for FI03279.complete
Subject Subject Range Query Range Percent Splice Strand
CG5830-RA 1..3533 2..3532 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:17:14 Download gff for FI03279.complete
Subject Subject Range Query Range Percent Splice Strand
CG5830-RA 1..3533 2..3532 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:41:46 Download gff for FI03279.complete
Subject Subject Range Query Range Percent Splice Strand
CG5830-RA 2..3534 1..3532 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-27 13:48:21 Download gff for FI03279.complete
Subject Subject Range Query Range Percent Splice Strand
CG5830-RA 1..3533 2..3532 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:40:50 Download gff for FI03279.complete
Subject Subject Range Query Range Percent Splice Strand
CG5830-RA 2..3534 1..3532 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:40:50 Download gff for FI03279.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16004349..16004735 1..387 99   Minus
3L 16003899..16004074 388..563 100 <- Minus
3L 15995610..15995845 564..799 100 <- Minus
3L 15995358..15995539 800..981 100 <- Minus
3L 15995135..15995288 982..1135 100 <- Minus
3L 15992669..15995066 1136..3532 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:41:46 Download gff for FI03279.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15997449..15997835 1..387 99   Minus
arm_3L 15996999..15997174 388..563 100 <- Minus
arm_3L 15988710..15988945 564..799 100 <- Minus
arm_3L 15988458..15988639 800..981 100 <- Minus
arm_3L 15988235..15988388 982..1135 100 <- Minus
arm_3L 15985769..15988166 1136..3532 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:48:18 Download gff for FI03279.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15997449..15997835 1..387 99   Minus
3L 15996999..15997174 388..563 100 <- Minus
3L 15988710..15988945 564..799 100 <- Minus
3L 15988458..15988639 800..981 100 <- Minus
3L 15988235..15988388 982..1135 100 <- Minus
3L 15985769..15988166 1136..3532 99 <- Minus

FI03279.pep Sequence

Translation from 481 to 1470

> FI03279.pep
MDATSIITQVSRDDEQLNVYPSYPNDKDDVDRLKPQKRGLFHSLLCCWRR
NRTKTNQNGTQIDGSTTPPPLPDQQRYLLPQVRLTDMHRKCMVIDLDETL
VHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLF
TASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQK
IVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLSKVDSVY
SVLCNSNQPLNNQTNQQQHPQELQQAPNQLHQQLQQQQQQQTISATTVIT
QATTLSAPTMLNQQQTSPPSPQSELLQKT*

FI03279.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10364-PA 329 GF10364-PA 1..304 1..312 1492 93.9 Plus
Dana\GF21841-PA 218 GF21841-PA 29..208 83..253 359 43.3 Plus
Dana\GF12569-PA 282 GF12569-PA 81..275 69..253 276 37.4 Plus
Dana\GF24377-PA 264 GF24377-PA 44..241 64..253 244 31.3 Plus
Dana\GF22482-PA 411 GF22482-PA 237..389 130..276 209 32.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13507-PA 324 GG13507-PA 1..324 1..329 1651 97.6 Plus
Dere\GG17544-PA 243 GG17544-PA 54..233 83..253 357 43.3 Plus
Dere\GG10624-PA 294 GG10624-PA 89..276 83..253 275 37.8 Plus
Dere\GG14268-PA 260 GG14268-PA 47..242 67..253 215 30.8 Plus
Dere\GG14712-PA 411 GG14712-PA 237..405 130..303 208 31.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16757-PA 341 GH16757-PA 1..299 1..312 1439 90.4 Plus
Dgri\GH12888-PA 243 GH12888-PA 54..233 83..253 355 43.3 Plus
Dgri\GH21358-PA 294 GH21358-PA 104..291 89..259 303 37.2 Plus
Dgri\GH17760-PA 407 GH17760-PA 233..385 130..276 198 30.7 Plus
Dgri\GH15740-PA 410 GH15740-PA 237..388 130..276 193 34.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG5830-PA 329 CG5830-PA 1..329 1..329 1738 100 Plus
CG5830-PB 352 CG5830-PB 1..352 1..329 1704 93.5 Plus
Dd-PB 240 CG1696-PB 51..230 83..253 358 43.3 Plus
Dd-PA 243 CG1696-PA 54..233 83..253 358 43.3 Plus
CG8584-PA 293 CG8584-PA 89..275 83..253 286 37.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13418-PA 331 GI13418-PA 1..331 1..329 1496 90.1 Plus
Dmoj\GI14442-PA 243 GI14442-PA 54..233 83..253 351 42.8 Plus
Dmoj\GI20773-PA 313 GI20773-PA 105..301 69..253 285 35.1 Plus
Dmoj\GI12759-PA 245 GI12759-PA 21..245 83..284 223 28.4 Plus
Dmoj\GI15094-PA 409 GI15094-PA 209..387 89..276 208 28.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12819-PA 333 GL12819-PA 1..333 1..329 1465 91.6 Plus
Dper\GL16570-PA 175 GL16570-PA 33..165 122..253 284 44.4 Plus
Dper\GL17365-PA 286 GL17365-PA 92..279 82..253 276 35.1 Plus
Dper\GL19342-PA 274 GL19342-PA 67..250 83..253 231 33.7 Plus
Dper\GL19807-PA 310 GL19807-PA 136..304 130..303 206 27.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19163-PA 335 GA19163-PA 1..335 1..329 1463 91.3 Plus
Dpse\GA14238-PA 243 GA14238-PA 54..233 83..253 357 43.3 Plus
Dpse\GA21180-PA 286 GA21180-PA 92..279 82..253 281 35.1 Plus
Dpse\GA25924-PA 306 GA25924-PA 99..282 83..253 230 33.7 Plus
Dpse\GA15443-PA 390 GA15443-PA 216..384 130..303 203 26.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24453-PA 412 GM24453-PA 110..412 29..329 1464 97.7 Plus
Dsec\GM22628-PA 243 GM22628-PA 54..233 83..253 357 43.3 Plus
Dsec\GM20669-PA 293 GM20669-PA 89..275 83..253 293 39.6 Plus
Dsec\GM14061-PA 253 GM14061-PA 64..232 83..243 207 30.4 Plus
Dsec\GM14328-PA 401 GM14328-PA 227..374 130..275 188 31.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12523-PA 331 GD12523-PA 1..331 1..329 1595 97.6 Plus
Dsim\GD10142-PA 623 GD10142-PA 419..605 83..253 285 39.6 Plus
Dsim\GD24432-PA 139 GD24432-PA 29..135 83..180 200 43 Plus
Dsim\GD16356-PA 428 GD16356-PA 254..406 130..276 195 31.4 Plus
Dsim\GD13336-PA 253 GD13336-PA 64..232 83..243 194 30.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11778-PA 329 GJ11778-PA 1..300 1..312 1433 90.4 Plus
Dvir\GJ18780-PA 243 GJ18780-PA 54..233 83..253 359 43.3 Plus
Dvir\GJ20507-PA 305 GJ20507-PA 114..305 89..264 283 36.8 Plus
Dvir\GJ18901-PA 413 GJ18901-PA 239..391 130..276 206 31.4 Plus
Dvir\GJ15525-PA 288 GJ15525-PA 75..257 90..253 200 30.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23622-PA 325 GK23622-PA 1..325 1..329 1409 87 Plus
Dwil\GK16309-PA 243 GK16309-PA 54..233 83..253 357 43.3 Plus
Dwil\GK23052-PA 275 GK23052-PA 84..269 84..253 275 36.2 Plus
Dwil\GK18701-PA 375 GK18701-PA 171..322 89..253 210 30.5 Plus
Dwil\GK14784-PA 400 GK14784-PA 225..377 130..276 198 32.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23126-PA 325 GE23126-PA 1..325 1..329 1593 97.9 Plus
Dyak\GE15304-PA 243 GE15304-PA 54..233 83..253 357 43.3 Plus
Dyak\GE22820-PA 294 GE22820-PA 89..276 83..253 287 38.8 Plus
Dyak\GE20696-PA 260 GE20696-PA 64..242 83..253 215 31.8 Plus
Dyak\GE16923-PA 424 GE16923-PA 250..402 130..276 206 33.3 Plus

FI03279.hyp Sequence

Translation from 481 to 1470

> FI03279.hyp
MDATSIITQVSRDDEQLNVYPSYPNDKDDVDRLKPQKRGLFHSLLCCWRR
NRTKTNQNGTQIDGSTTPPPLPDQQRYLLPQVRLTDMHRKCMVIDLDETL
VHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECVLF
TASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRLGRDLQK
IVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLSKVDSVY
SVLCNSNQPLNNQTNQQQHPQELQQAPNQLHQQLQQQQQQQTISATTVIT
QATTLSAPTMLNQQQTSPPSPQSELLQKT*

FI03279.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:29:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG5830-PA 329 CG5830-PA 1..329 1..329 1738 100 Plus
CG5830-PB 352 CG5830-PB 1..352 1..329 1704 93.5 Plus
Dd-PB 240 CG1696-PB 51..230 83..253 358 43.3 Plus
Dd-PA 243 CG1696-PA 54..233 83..253 358 43.3 Plus
CG8584-PA 293 CG8584-PA 89..275 83..253 286 37.4 Plus