Clone FI03292 Report

Search the DGRC for FI03292

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:32
Well:92
Vector:pFlc-1
Associated Gene/TranscriptCyp6a23-RA
Protein status:FI03292.pep: gold
Sequenced Size:1773

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Cyp6a23 2008-12-18 5.12 accounting

Clone Sequence Records

FI03292.complete Sequence

1773 bp assembled on 2008-09-15

GenBank Submission: BT044492.1

> FI03292.complete
TGAGTGTGGAGCGGACTGAGAACGAAATATGTCGCTGTTACTAACGTTGA
TCGCACTTCTAGTGTCACTGCTTTTGTTCATGGCCCGCCGACGTCATGGA
TACTGGCAGAGGCGGGGTATTCCGCACGATGTGCCCCATCCAATATACGG
AAACATGAAGGACTGGCCCAAGAAGCGACACATTGCGATGATCTTCCGGG
ACTACTATACAAAGTACAAACGTTCCGTTTATCCGTTTGCCGGGTTCTAC
TTCTTTTTCACCCGGTCTGCTGTCATCACCGACTTGGAATTGGTCAAGAG
GGTGCTGATCAAGGACTTCAATCACTTTGAGAATCGAGGAATTTTCTACA
ATGAGATCGATGATCCGCTGTCGGCCACCTTGTTCAGCATCGAGGGTCAG
AAGTGGCGTCATCTGAGGCACAAACTGACACCCACTTTTACGTCCGGCAA
AATGAAGAACATGTTTCCGATTATTGTGAAGGTTGGGGAGGAAATGGAGA
AGATTTTCAGTGCTAAAACCACCACAGGTGAAGGTCAAGTTCTGGAAATT
GTGGATCTGGTGGCTCGATATACGGCTGACGTAATCGGTAATTGCGCCTT
CGGTTTAAATTGCAATAGTTTGCAAAACCCGAATGCAGAGTTTGTGACAA
TCGGAAAAAGGGCGATCATAGAACGTCGTTATGGAGGACTATTGGATTTC
CTGATATTCGGATTTCCCAAACTTTCCCGCCGCCTGCGGCTTAAACTAAA
CGTGCAGGATGTTGAGGACTTTTACACTAGCATTGTTAGGAATACTATCG
ACTACCGATTGAGGACCAACGAGAAGCGTCACGACTTCATGGACAGTTTA
ATCGAAATGTACGAGAAGGAGCAGGCCGGAAACACTGAGGATGGCCTGTC
CTTCAACGAGATCTTGGCACAGGCCTTTATTTTCTTTGTGGCTGGCTTCG
AGACCAGCTCGACGACCATGGGATTTGCCCTGTACGAGCTCGCCCTCGAT
CAGGATATTCAGGATCAACTTAGGGCGGAGATCAACAATGTTCTGAGCAA
ACACAACAACGAGTTTACCTACGAGGGAATCAAAGAGATGAAGTATCTGG
AGCAGGTCGTCATGGAAACCCTTCGCAAGTATCCAGTTCTGGCGCATCTA
ACGCGAATGACCCAGACAGATTTTTCGCCTGAAGATCCTAAATACTTTAT
TGCCAAGGGAACCACTGTTGTGATCCCAGCTCTTGGTATTCACTATGATC
CGGAAATCTATCCCGAACCGGAGAAGTTCAAGCCGGAGCGATTTACGGAT
GAGGCGATCGCCGCGAGACCCTCGTGCACCTGGCTGCCGTTTGGAGAAGG
TCCCCGGAACTGCATCGGTCTTCGGTTTGGACTGATGCAGGCCTGCGTGG
GATTGGCCTATCTAATCCGAGGCTATAAGTTCAGTGTGTCCACAGAAACA
CAAATTCCCATGAAGTTTGTCGTGAAAAGCATTCTTCTGTCTGCTGAGAA
TGGCATTCACCTTAAAGTTGAGAAGCTTTCCAAATGAGACTATAAACAAA
ATTATTATGGGCTTTAATGGTTAAATATTACAATTTTATTTGGTCATTTA
TTCACGGCTATATATGATTTTTTTGAATTAAATCCCTCTTAAAGCTCATA
TTCAGTATATGAGAGTATAGCATTCAAATTAAGCCTTGTTAGTTTGTTGT
TGTAAATTTATTGTAAATATTTGTGGTAATACCCTCAATAAATTTTTGTT
CAGCTTTAAAAAAAAAAAAAAAA

FI03292.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a23-RA 1919 Cyp6a23-RA 112..1866 3..1757 8775 100 Plus
Cyp6a17-RA 1818 Cyp6a17-RA 797..1622 710..1535 1715 80.5 Plus
Cyp6a17-RA 1818 Cyp6a17-RA 235..607 148..520 1175 87.6 Plus
CG10245.a 1999 CG10245.a 1074..1206 891..1023 260 79.6 Plus
Cyp6a17-RA 1818 Cyp6a17-RA 620..755 533..668 230 77.9 Plus
Cyp6a17-RA 1818 Cyp6a17-RA 152..216 65..129 175 84.6 Plus
CG10245.a 1999 CG10245.a 1517..1574 1334..1391 170 86.2 Plus
CG10245.a 1999 CG10245.a 608..654 422..468 145 87.2 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10763161..10764273 3..1115 5535 99.8 Plus
chr2R 21145070 chr2R 10764335..10764977 1115..1757 3125 99.1 Plus
chr2R 21145070 chr2R 10761339..10762389 65..1115 2015 79.4 Plus
chr2R 21145070 chr2R 10762449..10762869 1115..1535 1070 83.6 Plus
chr2R 21145070 chr2R 10770332..10770464 891..1023 260 79.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a23-RA 1509 CG10242-PA 1..1509 29..1537 7545 100 Plus
Cyp6a17-RB 1506 CG10241-PB 34..1504 65..1535 3080 80.6 Plus
Cyp6a17-RA 1506 CG10241-PA 34..1504 65..1535 3080 80.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:08 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a23-RA 1761 CG10242-RA 7..1761 3..1757 8775 100 Plus
Cyp6a17-RB 1727 CG10241-RB 61..1531 65..1535 3080 80.6 Plus
Cyp6a17-RA 1546 CG10241-RA 61..1531 65..1535 3080 80.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a23-PA 502 CG10242-PA 17..502 77..1534 2556 100 Plus
Cyp6a17-PB 501 CG10241-PB 16..501 77..1534 2246 85.2 Plus
Cyp6a17-PA 501 CG10241-PA 16..501 77..1534 2246 85.2 Plus
Cyp6a20-PB 501 CG10245-PB 25..501 101..1528 1443 56.3 Plus
Cyp6a19-PA 503 CG10243-PA 21..500 89..1528 1347 51.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14875835..14876947 3..1115 5565 100 Plus
2R 25286936 2R 14877012..14877654 1115..1757 3215 100 Plus
2R 25286936 2R 14874013..14875063 65..1115 2015 79.4 Plus
2R 25286936 2R 14875123..14875543 1115..1535 1070 83.6 Plus
2R 25286936 2R 14882993..14883125 891..1023 260 79.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14877034..14878146 3..1115 5565 100 Plus
2R 25260384 2R 14878211..14878853 1115..1757 3215 100 Plus
2R 25260384 2R 14875295..14875667 148..520 1175 87.6 Plus
2R 25260384 2R 14876322..14876742 1115..1535 1070 83.6 Plus
2R 25260384 2R 14875857..14876262 710..1115 650 77.3 Plus
2R 25260384 2R 14884192..14884324 891..1023 260 79.6 Plus
2R 25260384 2R 14875680..14875815 533..668 230 77.9 Plus
2R 25260384 2R 14887072..14887164 1012..920 180 79.5 Minus
2R 25260384 2R 14875212..14875276 65..129 175 84.6 Plus
2R 25260384 2R 14879361..14879439 388..466 170 81 Plus
2R 25260384 2R 14888739..14888802 1392..1329 170 84.3 Minus
2R 25260384 2R 14884763..14884820 1334..1391 170 86.2 Plus
2R 25260384 2R 14889206..14889279 987..914 160 81 Minus
2R 25260384 2R 14881531..14881604 1014..941 160 81 Minus
2R 25260384 2R 14883726..14883772 422..468 145 87.2 Plus
2R 25260384 2R 14886621..14886697 1407..1331 145 79.2 Minus
2R 25260384 2R 14887619..14887655 468..432 140 91.8 Minus
Blast to na_te.dros performed on 2014-11-27 11:01:24 has no hits.

FI03292.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:54:39 Download gff for FI03292.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10764336..10764977 1116..1757 99   Plus
chr2R 10763159..10764273 1..1115 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:43:56 Download gff for FI03292.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a23-RA 1..1509 29..1537 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:09:22 Download gff for FI03292.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a23-RA 1..1509 29..1537 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:26:36 Download gff for FI03292.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a23-RA 1..1509 29..1537 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:54:39 Download gff for FI03292.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a23-RA 1..1509 29..1537 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:48:31 Download gff for FI03292.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a23-RA 1..1757 1..1757 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:09:22 Download gff for FI03292.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a23-RA 1..1757 1..1757 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:26:36 Download gff for FI03292.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a23-RA 5..1761 1..1757 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-15 12:13:23 Download gff for FI03292.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a23-RA 1..1757 1..1757 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:54:39 Download gff for FI03292.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a23-RA 5..1761 1..1757 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:54:39 Download gff for FI03292.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14877013..14877654 1116..1757 100   Plus
2R 14875833..14876947 1..1115 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:26:36 Download gff for FI03292.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10764518..10765159 1116..1757 100   Plus
arm_2R 10763338..10764452 1..1115 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:39:12 Download gff for FI03292.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14878212..14878853 1116..1757 100   Plus
2R 14877032..14878146 1..1115 99 -> Plus

FI03292.pep Sequence

Translation from 28 to 1536

> FI03292.pep
MSLLLTLIALLVSLLLFMARRRHGYWQRRGIPHDVPHPIYGNMKDWPKKR
HIAMIFRDYYTKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHF
ENRGIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIV
KVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNCAFGLNCNSLQN
PNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKLNVQDVEDFYT
SIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAF
IFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEG
IKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIP
ALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRF
GLMQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEKL
SK*

FI03292.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 22:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12302-PA 502 GF12302-PA 1..502 1..502 2360 84.9 Plus
Dana\GF12301-PA 500 GF12301-PA 1..499 1..501 2198 78 Plus
Dana\GF12300-PA 502 GF12300-PA 30..502 30..502 2182 83.9 Plus
Dana\GF12303-PA 501 GF12303-PA 1..501 1..500 1517 55.2 Plus
Dana\GF13788-PA 506 GF13788-PA 1..506 1..500 1374 49.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 22:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20488-PA 501 GG20488-PA 14..501 15..502 2259 84.6 Plus
Dere\GG20489-PA 504 GG20489-PA 1..503 4..502 1506 54.4 Plus
Dere\GG10797-PA 506 GG10797-PA 1..506 1..500 1323 48.2 Plus
Dere\GG22385-PA 510 GG22385-PA 6..504 3..498 1281 48.7 Plus
Dere\GG20487-PA 499 GG20487-PA 7..496 5..502 1275 48.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 22:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21101-PA 500 GH21101-PA 1..500 1..502 1914 70.1 Plus
Dgri\GH20135-PA 506 GH20135-PA 1..506 1..500 1320 48.4 Plus
Dgri\Cyp6a9-PA 504 GH20805-PA 5..504 2..500 1250 48.2 Plus
Dgri\GH21100-PA 497 GH21100-PA 4..495 4..501 1237 46.9 Plus
Dgri\GH20806-PA 504 GH20806-PA 7..504 4..500 1235 47.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a23-PA 502 CG10242-PA 1..502 1..502 2622 100 Plus
Cyp6a17-PB 501 CG10241-PB 2..501 3..502 2283 84.4 Plus
Cyp6a17-PA 501 CG10241-PA 2..501 3..502 2283 84.4 Plus
Cyp6a20-PB 501 CG10245-PB 1..501 4..500 1460 54.8 Plus
Cyp6a19-PA 503 CG10243-PA 1..500 1..500 1369 50.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 22:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18702-PA 500 GI18702-PA 1..499 1..501 2008 72.1 Plus
Dmoj\GI18703-PA 472 GI18703-PA 1..472 1..502 1801 65.7 Plus
Dmoj\GI20230-PA 506 GI20230-PA 7..506 4..500 1313 49.6 Plus
Dmoj\GI20228-PA 506 GI20228-PA 1..506 1..500 1283 47.2 Plus
Dmoj\GI20229-PA 506 GI20229-PA 1..506 1..500 1268 46.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 22:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10374-PA 500 GL10374-PA 1..500 1..502 2349 84.9 Plus
Dper\GL10373-PA 500 GL10373-PA 1..500 1..502 2333 84.3 Plus
Dper\GL10375-PA 503 GL10375-PA 1..503 1..502 1539 55.4 Plus
Dper\GL10973-PA 506 GL10973-PA 1..506 1..500 1315 47.2 Plus
Dper\GL11709-PA 471 GL11709-PA 6..471 3..500 1210 47.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 22:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24954-PA 500 GA24954-PA 1..500 1..502 2351 85.1 Plus
Dpse\GA24953-PA 500 GA24953-PA 1..500 1..502 2330 84.3 Plus
Dpse\GA24955-PA 501 GA24955-PA 1..501 1..502 1526 55.2 Plus
Dpse\GA10190-PA 504 GA10190-PA 6..504 3..500 1326 50.4 Plus
Dpse\GA21788-PA 506 GA21788-PA 1..506 1..500 1315 47.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 22:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21579-PA 502 GM21579-PA 1..502 1..502 2577 95.2 Plus
Dsec\GM21578-PA 501 GM21578-PA 12..501 13..502 2280 85.5 Plus
Dsec\GM20849-PA 506 GM20849-PA 1..506 1..500 1338 49.4 Plus
Dsec\GM20167-PA 519 GM20167-PA 19..517 3..498 1328 49.3 Plus
Dsec\GM21577-PA 499 GM21577-PA 7..496 5..502 1255 47.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 22:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11084-PA 502 GD11084-PA 1..502 1..502 2599 95.8 Plus
Dsim\GD11083-PA 501 GD11083-PA 2..501 3..502 2325 85.2 Plus
Dsim\GD11087-PA 501 GD11087-PA 1..501 1..500 1517 55 Plus
Dsim\GD11086-PA 503 GD11086-PA 1..502 1..502 1419 50.3 Plus
Dsim\Cyp6a26-PA 506 GD10300-PA 1..506 1..500 1356 49.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 22:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21721-PA 500 GJ21721-PA 1..500 1..502 2038 71.9 Plus
Dvir\GJ20178-PA 508 GJ20178-PA 1..507 1..501 1288 46.9 Plus
Dvir\GJ20179-PA 507 GJ20179-PA 1..505 3..498 1285 48.1 Plus
Dvir\GJ21720-PA 496 GJ21720-PA 1..496 4..502 1280 49.3 Plus
Dvir\GJ20586-PA 499 GJ20586-PA 1..499 1..500 1251 48 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 22:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21512-PA 501 GK21512-PA 20..501 20..500 2111 78.4 Plus
Dwil\GK21513-PA 501 GK21513-PA 20..501 20..500 2097 78.2 Plus
Dwil\GK21511-PA 501 GK21511-PA 20..501 20..500 2068 77.2 Plus
Dwil\GK21516-PA 505 GK21516-PA 24..502 24..500 1577 61.3 Plus
Dwil\GK15638-PA 499 GK15638-PA 1..498 1..500 1564 57.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 22:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13619-PA 502 GE13619-PA 1..502 1..502 2473 90.2 Plus
Dyak\GE13618-PA 501 GE13618-PA 19..501 20..502 2252 85.1 Plus
Dyak\GE13621-PA 504 GE13621-PA 1..503 4..502 1514 54.4 Plus
Dyak\GE13620-PA 503 GE13620-PA 1..502 1..502 1462 52.5 Plus
Dyak\GE24465-PA 506 GE24465-PA 1..506 1..500 1345 49.8 Plus

FI03292.hyp Sequence

Translation from 28 to 1536

> FI03292.hyp
MSLLLTLIALLVSLLLFMARRRHGYWQRRGIPHDVPHPIYGNMKDWPKKR
HIAMIFRDYYTKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHF
ENRGIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIV
KVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNCAFGLNCNSLQN
PNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKLNVQDVEDFYT
SIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAF
IFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEG
IKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIP
ALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRF
GLMQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEKL
SK*

FI03292.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a23-PA 502 CG10242-PA 1..502 1..502 2622 100 Plus
Cyp6a17-PB 501 CG10241-PB 2..501 3..502 2283 84.4 Plus
Cyp6a17-PA 501 CG10241-PA 2..501 3..502 2283 84.4 Plus
Cyp6a20-PB 501 CG10245-PB 1..501 4..500 1460 54.8 Plus
Cyp6a19-PA 503 CG10243-PA 1..500 1..500 1369 50.1 Plus