Clone FI03326 Report

Search the DGRC for FI03326

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:33
Well:26
Vector:pFlc-1
Associated Gene/TranscriptCG15533-RA
Protein status:FI03326.pep: gold
Sequenced Size:2213

Clone Sequence Records

FI03326.complete Sequence

2213 bp assembled on 2009-08-17

GenBank Submission: BT099623.1

> FI03326.complete
AGTTGCTCTGCGAACCATGAAAGCAATCGGAATCCTGCTGGCGATCGCCT
TGACCTCCGGGTTCCTGGTGGTCTCCGCCGTAAACTTGCCGGGAGTGCCC
GTGGACTTCGACCTGGACGACCACATCCTGTCCGCCATTGCAGACGACAT
AGCCGAGCGTCTGGCCAGGGAGTACATCACCTTCCTGAAGACCGGAGTGG
AGACGGCGGAGTTCTTGAAGCTCACCAATCAGCTGGCCAAGTCGCACAGT
GAGAAGGATATATTCACCAGGAACATGCCCGATCTAGAGCCCAGGGATAG
CTTCTTTGCGTGCGTGGCCTGTCGCTCGGTGACGCGGGTTTTGATTCGCA
CCATTCGCGAGGAGGACGGCGAGCTCCACGGGGAGAATAGCTCCGTTCTG
ATGAAGGAATTCGCTATGGACGTGTGCCGCCGCTTGAATCTGCAAACGGA
GGAGGTCTGCGAGGGATTGATCGATTCCAACCTGCCCTCCGTGGAGTACA
TCATGAGGAACTCCGAGAGTGATTCCCAGAGCTTCTGCTCCTTGTTCATG
GAGTTTAACTTCTGTAACACCGGTACAAATCAAGATTACAATTGGACCTT
GACTATAGACAATACTGGAGAGGCTTCGGCTGGCCCCAAGTCGGACACTC
CCACCTTTCAGGACTCGGACATCAGGATCTGCCAGTTCTCCGACATTCAC
CATGATCCCTACTACACCCCCGGCAGCCTGGCCACTTGTGCGGAACCCAT
GTGCTGTCAGAGGAACAAGGAGACCACCGAGGGTACGTCGGATGCAGCTG
GATACTGGGGCGACTACCGGGACTGCGATCTGCCTTGGCACGCCTTCGAG
TCAGCATTGGACAACGCGGTGGCCAACTCCAAGTGCGACTTCATTTACCA
GACTGGCGACATAGTGGACCACATGGTGTGGGCCACTTCCGTGGAGAAGA
ACACCATGGTGCTGACCAAGGTCAGTGAGCGGCTAAACGCGGCCTTCGGA
GATGTACCCGTATATCCCTGCATCGGAAACCACGAGCCTCATCCACTCAA
CCTCTTCAGTCCCGAGGGCGTTCCAGATGAGATCAGCACCAAGTGGCTCT
ATGAGCACCTGTACAACGATTGGTCCAAGTGGCTGCCGGCTGAAACCAAG
GAAACCATCCTTAAAGGAGGTTACTACACGGTGGTGCCCAGGAAGGGCTT
CCGTATCATCGCTCTAAACAGCAACGATTGCTATACGGACAACTTCTGGT
TGTATCACAGCGGCACGGACAAGATTCCCCAACTCCAGTGGTTCCACGAT
ACCCTGTTGGAGGCCGAGAAGAACGGGGAGTATGTCCACGTGCTGACCCA
CATTCCTTCGGGCGATGGAACCTGCTGGTCCGTTTGGGCTCGGGAATTCA
ACCGCTGCGTATCCCGCTTCAGGTCCACAATCAGTGGCATTTTCACAGGA
CACTCGCACAAGGACGAGCTATTCGTTTACTACTCGGAGGATGAAGGACA
CCCCACCGCAGTGGCGTGGAACGGAGGTGCTGTTACCACCTACTCCAACA
AGAACCCCAACTACCGAGAGTACGCCGTCAATCCCGAAACTTACACTGTG
ACCAACCACTGGACGTGGATTTACAACCTGACTGCTGCCAATCTGAAGCC
AGATGAACAGCCCGAGTGGTTCCTGGAGTACGAGTTCATCAAGGAGTTCA
CGGAAGATATGAGTCCGGCCGGAATCAGCAAGCTGCTCGATGAGTTCGCC
GAGAATCCCGAATTGATGAGAAAGTACTGGCGCTACCGAGTGACCTCAGC
AGATCCCCAGGTGAATGGAGGTTGTGATCGCAGCTGCTTGGCAGGATCTC
TTTGCCGAGCTGCTGTGACCATCAATTCCGAGCGAGAACGCTGCGAGGAG
CTGCGTGAGAAGTTGTTTGCCTCGCTGGACAATGAGGAGAGCACATCGTC
GTCGGGAAGCACTGAAGCCACCACCCCAAGTCCCAGCACCCCAGGGGGCA
ACGATGACAACGACGGTGGAGGATCCTCCACTTTGGGACTGCTCAGCGTT
AGCTCCCTGCTGGCTATAGTCCTCTCCATCCGCCTAGCCTTGTAGTAATC
CTCATTTGTACCCCCTAAGTTATATAAACCGAATGGATTCCATTCTAAAA
GTAACCGCTCTCAAGTGGCAAATAGAAGTATGCGCTTATCCCTATCGAAA
AAAAAAAAAAAAA

FI03326.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:31:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG15533-RA 2454 CG15533-RA 87..2286 1..2200 10970 99.9 Plus
CG15533.a 2454 CG15533.a 87..2286 1..2200 10970 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26251377..26252429 1..1053 5025 98.5 Plus
chr3R 27901430 chr3R 26252641..26253361 1054..1774 3455 98.6 Plus
chr3R 27901430 chr3R 26253642..26253915 1924..2197 1310 98.5 Plus
chr3R 27901430 chr3R 26253430..26253581 1773..1924 730 98.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG15533-RA 2079 CG15533-PA 1..2079 17..2095 10365 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:14 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG15533-RA 2203 CG15533-RA 7..2203 1..2197 10955 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG15533-PA 692 CG15533-PA 1..666 17..2014 3418 100 Plus
CG15534-PA 666 CG15534-PA 8..611 14..1870 1560 46.5 Plus
CG3376-PB 708 CG3376-PB 158..668 311..1855 785 33.3 Plus
CG3376-PD 726 CG3376-PD 158..668 311..1855 785 33.3 Plus
CG3376-PA 735 CG3376-PA 158..668 311..1855 785 33.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30428826..30429878 1..1053 5250 99.9 Plus
3R 32079331 3R 30430083..30430803 1054..1774 3590 99.9 Plus
3R 32079331 3R 30431089..30431365 1924..2200 1385 100 Plus
3R 32079331 3R 30430877..30431028 1773..1924 760 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30169657..30170709 1..1053 5250 99.9 Plus
3R 31820162 3R 30170914..30171634 1054..1774 3590 99.8 Plus
3R 31820162 3R 30171920..30172196 1924..2200 1385 100 Plus
3R 31820162 3R 30171708..30171859 1773..1924 760 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:53:54 has no hits.

FI03326.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:01:48 Download gff for FI03326.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26253643..26253915 1925..2197 98   Plus
chr3R 26253432..26253581 1775..1924 98 -> Plus
chr3R 26252641..26253361 1054..1774 98 -> Plus
chr3R 26251377..26252429 1..1053 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:14:35 Download gff for FI03326.complete
Subject Subject Range Query Range Percent Splice Strand
CG15533-RA 1..2079 17..2095 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:59:38 Download gff for FI03326.complete
Subject Subject Range Query Range Percent Splice Strand
CG15533-RA 1..2079 17..2095 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:32:27 Download gff for FI03326.complete
Subject Subject Range Query Range Percent Splice Strand
CG15533-RA 1..2079 17..2095 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:01:48 Download gff for FI03326.complete
Subject Subject Range Query Range Percent Splice Strand
CG15533-RA 1..2079 17..2095 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-17 17:19:25 Download gff for FI03326.complete
Subject Subject Range Query Range Percent Splice Strand
CG15533-RA 1..2197 1..2197 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:59:37 Download gff for FI03326.complete
Subject Subject Range Query Range Percent Splice Strand
CG15533-RA 1..2197 1..2197 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:32:27 Download gff for FI03326.complete
Subject Subject Range Query Range Percent Splice Strand
CG15533-RA 7..2203 1..2197 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:01:48 Download gff for FI03326.complete
Subject Subject Range Query Range Percent Splice Strand
CG15533-RA 7..2203 1..2197 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:01:48 Download gff for FI03326.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30431090..30431362 1925..2197 100   Plus
3R 30430879..30431028 1775..1924 100 -> Plus
3R 30430083..30430803 1054..1774 99 -> Plus
3R 30428826..30429878 1..1053 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:32:27 Download gff for FI03326.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26256812..26257084 1925..2197 100   Plus
arm_3R 26256601..26256750 1775..1924 100 -> Plus
arm_3R 26255805..26256525 1054..1774 99 -> Plus
arm_3R 26254548..26255600 1..1053 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:51:21 Download gff for FI03326.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30171921..30172193 1925..2197 100   Plus
3R 30171710..30171859 1775..1924 100 -> Plus
3R 30170914..30171634 1054..1774 99 -> Plus
3R 30169657..30170709 1..1053 99 -> Plus

FI03326.pep Sequence

Translation from 1 to 2094

> FI03326.pep
VALRTMKAIGILLAIALTSGFLVVSAVNLPGVPVDFDLDDHILSAIADDI
AERLAREYITFLKTGVETAEFLKLTNQLAKSHSEKDIFTRNMPDLEPRDS
FFACVACRSVTRVLIRTIREEDGELHGENSSVLMKEFAMDVCRRLNLQTE
EVCEGLIDSNLPSVEYIMRNSESDSQSFCSLFMEFNFCNTGTNQDYNWTL
TIDNTGEASAGPKSDTPTFQDSDIRICQFSDIHHDPYYTPGSLATCAEPM
CCQRNKETTEGTSDAAGYWGDYRDCDLPWHAFESALDNAVANSKCDFIYQ
TGDIVDHMVWATSVEKNTMVLTKVSERLNAAFGDVPVYPCIGNHEPHPLN
LFSPEGVPDEISTKWLYEHLYNDWSKWLPAETKETILKGGYYTVVPRKGF
RIIALNSNDCYTDNFWLYHSGTDKIPQLQWFHDTLLEAEKNGEYVHVLTH
IPSGDGTCWSVWAREFNRCVSRFRSTISGIFTGHSHKDELFVYYSEDEGH
PTAVAWNGGAVTTYSNKNPNYREYAVNPETYTVTNHWTWIYNLTAANLKP
DEQPEWFLEYEFIKEFTEDMSPAGISKLLDEFAENPELMRKYWRYRVTSA
DPQVNGGCDRSCLAGSLCRAAVTINSERERCEELREKLFASLDNEESTSS
SGSTEATTPSPSTPGGNDDNDGGGSSTLGLLSVSSLLAIVLSIRLAL*

FI03326.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18835-PA 695 GF18835-PA 1..695 6..697 2917 79.5 Plus
Dana\GF18837-PA 687 GF18837-PA 1..686 6..696 2822 73.4 Plus
Dana\GF22902-PA 669 GF22902-PA 10..633 17..645 1550 46.4 Plus
Dana\GF11387-PA 697 GF11387-PA 143..688 100..653 773 32.3 Plus
Dana\GF24679-PA 474 GF24679-PA 31..433 258..638 217 23.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11749-PA 687 GG11749-PA 1..687 6..697 3407 92.3 Plus
Dere\GG11750-PA 666 GG11750-PA 8..633 5..645 1594 47 Plus
Dere\GG22956-PA 728 GG22956-PA 147..692 100..653 751 32.4 Plus
Dere\GG15414-PA 479 GG15414-PA 19..434 245..638 199 24.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14054-PA 663 GH14054-PA 1..663 6..697 2661 69.8 Plus
Dgri\GH14043-PA 663 GH14043-PA 1..642 6..653 2587 71.5 Plus
Dgri\GH14065-PA 662 GH14065-PA 7..662 12..697 1609 44.2 Plus
Dgri\GH20981-PA 620 GH20981-PA 40..575 100..638 777 32.6 Plus
Dgri\GH15435-PA 497 GH15435-PA 18..433 230..618 222 23.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG15533-PA 692 CG15533-PA 1..692 6..697 3728 100 Plus
CG15534-PA 666 CG15534-PA 8..664 5..695 1654 45.4 Plus
CG3376-PA 735 CG3376-PA 158..722 104..665 802 32.2 Plus
CG3376-PC 764 CG3376-PC 187..751 104..665 802 32.2 Plus
CG3376-PB 708 CG3376-PB 158..696 104..650 796 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24854-PA 664 GI24854-PA 5..664 15..697 2666 70 Plus
Dmoj\GI24855-PA 665 GI24855-PA 22..650 26..660 1548 44.4 Plus
Dmoj\GI21317-PA 716 GI21317-PA 144..679 100..638 767 32.4 Plus
Dmoj\GI13036-PA 499 GI13036-PA 21..474 228..656 215 25.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13457-PA 675 GL13457-PA 1..639 6..649 2873 79.3 Plus
Dper\GL13458-PA 666 GL13458-PA 1..629 9..642 1663 48.6 Plus
Dper\GL20005-PA 471 GL20005-PA 131..456 100..431 504 32 Plus
Dper\GL16296-PA 499 GL16296-PA 54..430 267..618 208 25.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13791-PA 675 GA13791-PA 1..639 6..649 2875 79.5 Plus
Dpse\GA13792-PA 666 GA13792-PA 9..629 12..642 1667 49.1 Plus
Dpse\GA17413-PA 735 GA17413-PA 150..695 100..653 752 32.6 Plus
Dpse\GA17413-PB 711 GA17413-PB 150..695 100..653 751 32.6 Plus
Dpse\GA17413-PC 776 GA17413-PC 191..736 100..653 751 32.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12878-PA 690 GM12878-PA 1..690 6..697 3535 96.7 Plus
Dsec\GM12879-PA 666 GM12879-PA 8..636 5..648 1585 45.8 Plus
Dsec\GM11849-PA 632 GM11849-PA 160..630 212..683 694 34.6 Plus
Dsec\GM25187-PA 479 GM25187-PA 19..434 245..638 202 23.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21517-PA 446 GD21517-PA 1..446 250..697 2288 97.1 Plus
Dsim\GD21518-PA 444 GD21518-PA 8..444 5..455 988 42.6 Plus
Dsim\GD11848-PA 708 GD11848-PA 154..699 100..653 750 32.4 Plus
Dsim\GD21519-PA 188 GD21519-PA 1..167 490..676 481 49.2 Plus
Dsim\GD14219-PA 479 GD14219-PA 19..434 245..638 200 23.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24498-PA 667 GJ24498-PA 12..633 22..644 2634 75.4 Plus
Dvir\GJ24499-PA 668 GJ24499-PA 20..663 25..694 1604 45.1 Plus
Dvir\GJ21587-PA 748 GJ21587-PA 176..711 100..638 768 32.2 Plus
Dvir\GJ12131-PA 440 GJ12131-PA 2..355 288..618 184 22.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14133-PA 687 GK14133-PA 3..687 11..697 2657 71.2 Plus
Dwil\GK14134-PA 674 GK14134-PA 10..632 17..642 1569 46.6 Plus
Dwil\GK22200-PA 719 GK22200-PA 147..692 100..653 779 32.4 Plus
Dwil\GK11001-PA 498 GK11001-PA 28..466 228..636 218 22.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10876-PA 691 GE10876-PA 1..691 6..697 3361 92.2 Plus
Dyak\GE10877-PA 666 GE10877-PA 8..647 5..678 1596 45 Plus
Dyak\GE14393-PA 735 GE14393-PA 153..698 100..653 744 32.3 Plus
Dyak\GE21722-PA 497 GE21722-PA 12..446 228..638 217 25.1 Plus

FI03326.hyp Sequence

Translation from 1 to 2094

> FI03326.hyp
VALRTMKAIGILLAIALTSGFLVVSAVNLPGVPVDFDLDDHILSAIADDI
AERLAREYITFLKTGVETAEFLKLTNQLAKSHSEKDIFTRNMPDLEPRDS
FFACVACRSVTRVLIRTIREEDGELHGENSSVLMKEFAMDVCRRLNLQTE
EVCEGLIDSNLPSVEYIMRNSESDSQSFCSLFMEFNFCNTGTNQDYNWTL
TIDNTGEASAGPKSDTPTFQDSDIRICQFSDIHHDPYYTPGSLATCAEPM
CCQRNKETTEGTSDAAGYWGDYRDCDLPWHAFESALDNAVANSKCDFIYQ
TGDIVDHMVWATSVEKNTMVLTKVSERLNAAFGDVPVYPCIGNHEPHPLN
LFSPEGVPDEISTKWLYEHLYNDWSKWLPAETKETILKGGYYTVVPRKGF
RIIALNSNDCYTDNFWLYHSGTDKIPQLQWFHDTLLEAEKNGEYVHVLTH
IPSGDGTCWSVWAREFNRCVSRFRSTISGIFTGHSHKDELFVYYSEDEGH
PTAVAWNGGAVTTYSNKNPNYREYAVNPETYTVTNHWTWIYNLTAANLKP
DEQPEWFLEYEFIKEFTEDMSPAGISKLLDEFAENPELMRKYWRYRVTSA
DPQVNGGCDRSCLAGSLCRAAVTINSERERCEELREKLFASLDNEESTSS
SGSTEATTPSPSTPGGNDDNDGGGSSTLGLLSVSSLLAIVLSIRLAL*

FI03326.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG15533-PA 692 CG15533-PA 1..692 6..697 3728 100 Plus
CG15534-PA 666 CG15534-PA 8..664 5..695 1654 45.4 Plus
CG3376-PA 735 CG3376-PA 158..722 104..665 802 32.2 Plus
CG3376-PC 764 CG3376-PC 187..751 104..665 802 32.2 Plus
CG3376-PB 708 CG3376-PB 158..696 104..650 796 32.7 Plus