Clone FI03364 Report

Search the DGRC for FI03364

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:33
Well:64
Vector:pFlc-1
Associated Gene/Transcriptmthl5-RA
Protein status:FI03364.pep: gold
Sequenced Size:1963

Clone Sequence Records

FI03364.complete Sequence

1963 bp assembled on 2009-11-10

GenBank Submission: BT100276.1

> FI03364.complete
ATTCGCTTTTTGTCGTCGCTTCGAATCGGTTGATGTTGCTTCTTCAATTT
TTATTTCGTTTTGAATACTGTTTAAAGAGGAAGTAAAGCGCGCATTGTTT
ATTAACCGAATACGAGTCTGAAACCCAGACGAAAGTGCCTTTGTGGGTGT
GTTGATACAAAAAAAAGTGTCGCCTTACTTGAGTTCTGGCATGCAAGTCA
TGATCTTGGCTCACAGCCGGCACCTTGATGACGCATTTCTTAGCAAGCGC
AGATCCACATAAACACCAACGACAACTGCCTTTTACCTGTGTATTGTATT
TGTATCTGTGTCTGTGTTACTAAGCAAAAGATGCTCGTAAAAACGCTTGG
CGCGCATTTTGCAGCCGGGCAAAATGCAAAAAAATGCAGCTGCTGCGCTC
TGCTGATTTCCCTGCTCTGCGTATTACTTCTTAGTCTAAACCCTTTACCA
GTAACCAGTCATGTCACTAGCGCCGGATCATCAACAGCCCTATCTTCCGA
TCCCAACCTAGTGCTGGTCAACAAATGTTGCGAGAAGTTCGAGATACACG
TGGACCATGAGTGTCAGCAGGTCAATGAAACGGACTACTTCCAGCCGATG
TTCACCAGCTATGGAGGAGAGCAAAACAGGCCCGTTAAGTTCAAATTCGT
CATCGGGATTCCAAATTGTGGATCCATGCAGATGTGGCCAATATACCACT
ATGCTGGCAGCTCTGATAAGCTAGTGTTACTGGATGATGGGAGGCTAAGG
CATTACACCAATGCCGAAAACGAAGCAGAGGAGCGTCATGGAATACAATC
GGATTATGAGGAGGATATTGCCGGCAGTCTGGAACCGCTATACCATGACT
ACGATAAGGGATTGTATTGCATTGACAAGGCCACTTCCAGTACTGGAGAG
GAAAATGTGCTATTCGCCAACATTTGCTTGGCCCGCAAGGAGATCAAGTG
GAGTGACTCAAACTTTCTGCTCCGCAAAATCTTAAACCCAATTTTCCATG
GCATCTCGCTTGTTATCCTGCTGGTCATCGCCATCATCTATTTTATACTT
CCTACTCTCAGAGATCTGGTTGGTAACATTGTGACAACGATAGCCATGTG
CCTTATGGTAAGCCAGGCAGCAGACCTTGTCAGAATTTTCACCGAGCTGA
CCAGCCATGTGAGCTTCATTGTGGCGGACATTATCCTGTGCTTCAGCCTC
TTGGCAGCTTTCTTCTGGCTGAACAGTTTCGGTTTTTACATTTGGAAGAC
CTTTCGTTCGAGGAACGTCTTCCTGCGAGTCACGGACGGCAGGAAGTACT
GCTATTATTCTGCGTATGCTTGGGGATGCACAGCAACGATGGCTGCACTG
GCTGTCTTCGCACATTTCTTCCTCGACGCCGAATCCTACAAACAGGAGCA
CATGGTGGGCGAGCAAGAGACGATCGGCTGGCTAGGCATATGCATATTCT
TTGCTCCAATTGCTTGTACCATTTTGGTAAACATATTCTTCTATGTGACC
ACCAGGAAGTTGATTAACCGCAGGACGGTATACGGCCGCATTGCGCACAA
ATTGAAAGCCAATTTTATCATGTTCTCGCTGATGCTGTTAGTAATGTCTA
TAGCCTGGCTATTCCTCATAATGTCCTGGTTGCAGATGGAAGGCCTGCTT
TACGCCCACATCGTAGTTAACGCCCTGCAGACGCCGCTGTTGCTATACAT
ATGCGTGCTGCGCCAGCGACATGTGACATTTCTGCTGAAAAAGACCTGCT
GCTACAATGAGCCACCGTCGGCAAACGACTGGGGCGATGAGCTGCATTAT
ATGAACGGCAACGATTACTGAGGAGCCACCGTCCACACTAATATAAGTGT
TTTCGTAGTTTAGCAATGTCCAACATTGAGATTTGTACTTAATTTTAACT
AATTTATGCTGTACGAGATAGTTATTAAATGAGAAGTCTGACACCTAAAA
AAAAAAAAAAAAA

FI03364.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
mthl5-RA 2061 mthl5-RA 41..1987 1..1947 9735 100 Plus
mthl5.a 2024 mthl5.a 1..1950 1..1947 9680 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:16:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7712069..7712653 583..1 2770 98.6 Minus
chr3R 27901430 chr3R 7709869..7710372 1562..1059 2460 99.2 Minus
chr3R 27901430 chr3R 7709424..7709807 1946..1563 1905 99.7 Minus
chr3R 27901430 chr3R 7710428..7710611 1061..878 920 100 Minus
chr3R 27901430 chr3R 7710666..7710837 880..709 860 100 Minus
chr3R 27901430 chr3R 7710901..7711026 708..583 630 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
mthl5-RA 1491 CG6965-PA 1..1491 331..1821 7455 100 Plus
mthl5-RB 1494 CG6965-PB 1..1494 331..1821 7390 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:18 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
mthl5-RA 1949 CG6965-RA 4..1949 1..1946 9730 100 Plus
mthl5-RB 1952 CG6965-RB 4..1952 1..1946 9665 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:16:47
Subject Length Description Subject Range Query Range Score Percent Strand
mthl5-PA 496 CG6965-PA 1..496 331..1818 2435 100 Plus
mthl5-PB 497 CG6965-PB 1..497 331..1818 2423 99.8 Plus
mthl2-PB 518 CG17795-PB 287..487 1192..1743 177 26.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:16:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11886583..11887165 583..1 2915 100 Minus
3R 32079331 3R 11884383..11884886 1562..1059 2520 100 Minus
3R 32079331 3R 11883937..11884321 1947..1563 1925 100 Minus
3R 32079331 3R 11884942..11885125 1061..878 920 100 Minus
3R 32079331 3R 11885180..11885351 880..709 860 100 Minus
3R 32079331 3R 11885415..11885540 708..583 630 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11627414..11627996 583..1 2915 100 Minus
3R 31820162 3R 11625214..11625717 1562..1059 2520 100 Minus
3R 31820162 3R 11624768..11625152 1947..1563 1925 100 Minus
3R 31820162 3R 11625773..11625956 1061..878 920 100 Minus
3R 31820162 3R 11626011..11626182 880..709 860 100 Minus
3R 31820162 3R 11626246..11626371 708..583 630 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:16:42 has no hits.

FI03364.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:26:49 Download gff for FI03364.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7712069..7712653 1..583 98   Minus
chr3R 7710901..7711025 584..708 100 <- Minus
chr3R 7710667..7710837 709..879 100 <- Minus
chr3R 7710428..7710609 880..1061 100 <- Minus
chr3R 7709869..7710369 1062..1562 99 <- Minus
chr3R 7709424..7709807 1563..1946 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-10 10:22:29 Download gff for FI03364.complete
Subject Subject Range Query Range Percent Splice Strand
mthl5-RA 1..1491 331..1821 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:18:18 Download gff for FI03364.complete
Subject Subject Range Query Range Percent Splice Strand
mthl5-RA 1..1491 331..1821 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:59:06 Download gff for FI03364.complete
Subject Subject Range Query Range Percent Splice Strand
mthl5-RA 1..1491 331..1821 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:26:49 Download gff for FI03364.complete
Subject Subject Range Query Range Percent Splice Strand
mthl5-RA 1..1491 331..1821 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-10 10:22:29 Download gff for FI03364.complete
Subject Subject Range Query Range Percent Splice Strand
mthl5-RA 1..1946 1..1946 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:18:18 Download gff for FI03364.complete
Subject Subject Range Query Range Percent Splice Strand
mthl5-RA 1..1946 1..1946 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:59:06 Download gff for FI03364.complete
Subject Subject Range Query Range Percent Splice Strand
mthl5-RA 4..1949 1..1946 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:26:49 Download gff for FI03364.complete
Subject Subject Range Query Range Percent Splice Strand
mthl5-RA 4..1949 1..1946 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:26:49 Download gff for FI03364.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11886583..11887165 1..583 100   Minus
3R 11885415..11885539 584..708 100 <- Minus
3R 11885181..11885351 709..879 100 <- Minus
3R 11884942..11885123 880..1061 100 <- Minus
3R 11884383..11884883 1062..1562 100 <- Minus
3R 11883938..11884321 1563..1946 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:59:06 Download gff for FI03364.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7712305..7712887 1..583 100   Minus
arm_3R 7711137..7711261 584..708 100 <- Minus
arm_3R 7710903..7711073 709..879 100 <- Minus
arm_3R 7710664..7710845 880..1061 100 <- Minus
arm_3R 7710105..7710605 1062..1562 100 <- Minus
arm_3R 7709660..7710043 1563..1946 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:07:33 Download gff for FI03364.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11627414..11627996 1..583 100   Minus
3R 11626246..11626370 584..708 100 <- Minus
3R 11626012..11626182 709..879 100 <- Minus
3R 11625773..11625954 880..1061 100 <- Minus
3R 11625214..11625714 1062..1562 100 <- Minus
3R 11624769..11625152 1563..1946 100 <- Minus

FI03364.pep Sequence

Translation from 330 to 1820

> FI03364.pep
MLVKTLGAHFAAGQNAKKCSCCALLISLLCVLLLSLNPLPVTSHVTSAGS
STALSSDPNLVLVNKCCEKFEIHVDHECQQVNETDYFQPMFTSYGGEQNR
PVKFKFVIGIPNCGSMQMWPIYHYAGSSDKLVLLDDGRLRHYTNAENEAE
ERHGIQSDYEEDIAGSLEPLYHDYDKGLYCIDKATSSTGEENVLFANICL
ARKEIKWSDSNFLLRKILNPIFHGISLVILLVIAIIYFILPTLRDLVGNI
VTTIAMCLMVSQAADLVRIFTELTSHVSFIVADIILCFSLLAAFFWLNSF
GFYIWKTFRSRNVFLRVTDGRKYCYYSAYAWGCTATMAALAVFAHFFLDA
ESYKQEHMVGEQETIGWLGICIFFAPIACTILVNIFFYVTTRKLINRRTV
YGRIAHKLKANFIMFSLMLLVMSIAWLFLIMSWLQMEGLLYAHIVVNALQ
TPLLLYICVLRQRHVTFLLKKTCCYNEPPSANDWGDELHYMNGNDY*

FI03364.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23058-PA 498 GF23058-PA 1..498 1..496 2102 83.6 Plus
Dana\GF14128-PA 458 GF14128-PA 72..362 144..434 162 22.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17182-PA 496 GG17182-PA 1..496 1..496 2398 95.4 Plus
Dere\GG14666-PA 682 GG14666-PA 214..554 166..472 176 21.1 Plus
Dere\GG15277-PA 479 GG15277-PA 221..479 225..471 158 24.1 Plus
Dere\GG23966-PA 437 GG23966-PA 101..342 214..434 157 24 Plus
Dere\GG14665-PA 414 GG14665-PA 124..410 225..496 153 22.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18778-PA 492 GH18778-PA 1..492 1..496 1957 76.2 Plus
Dgri\GH16001-PA 628 GH16001-PA 147..487 141..469 205 22.4 Plus
Dgri\GH15468-PA 452 GH15468-PA 119..452 156..471 168 23.1 Plus
Dgri\GH15471-PA 322 GH15471-PA 114..308 288..463 161 25.6 Plus
Dgri\GH24384-PA 664 GH24384-PA 361..557 288..474 157 26.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
mthl5-PA 496 CG6965-PA 1..496 1..496 2630 100 Plus
mthl5-PB 497 CG6965-PB 1..497 1..496 2618 99.8 Plus
mthl2-PB 518 CG17795-PB 185..487 175..471 201 24.5 Plus
mthl15-PC 718 CG31720-PC 346..622 171..434 177 22.1 Plus
mthl10-PB 585 CG17061-PB 246..532 216..473 168 20.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22669-PA 492 GI22669-PA 1..492 1..496 1924 75.5 Plus
Dmoj\GI16743-PA 523 GI16743-PA 149..481 142..462 199 24.1 Plus
Dmoj\GI16744-PA 572 GI16744-PA 241..518 216..472 196 22.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12364-PA 454 GL12364-PA 5..454 47..496 2188 90.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19990-PA 484 GA19990-PA 1..484 1..496 2231 85.5 Plus
Dpse\GA14305-PA 684 GA14305-PA 272..557 208..472 178 22.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26062-PA 496 GM26062-PA 1..496 1..496 2449 97.4 Plus
Dsec\GM11932-PA 708 GM11932-PA 371..612 214..434 160 24 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20625-PA 496 GD20625-PA 1..496 1..496 2396 97 Plus
Dsim\GD13893-PA 508 GD13893-PA 274..481 281..471 170 25.2 Plus
Dsim\GD22291-PA 709 GD22291-PA 372..613 214..434 160 24 Plus
Dsim\GD25479-PA 517 GD25479-PA 91..448 66..442 151 21.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23397-PA 489 GJ23397-PA 31..489 41..496 2025 79.8 Plus
Dvir\GJ12490-PA 851 GJ12490-PA 538..839 216..494 189 23.5 Plus
Dvir\GJ12492-PA 541 GJ12492-PA 116..487 63..472 165 21.8 Plus
Dvir\GJ14760-PA 679 GJ14760-PA 389..596 277..474 153 26.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14472-PA 499 GK14472-PA 7..499 4..496 1634 65.4 Plus
Dwil\GK25390-PA 525 GK25390-PA 181..480 174..463 198 26.4 Plus
Dwil\GK20982-PA 518 GK20982-PA 182..514 175..495 195 23.5 Plus
Dwil\GK12065-PA 524 GK12065-PA 158..459 172..448 183 25.7 Plus
Dwil\GK20993-PA 783 GK20993-PA 181..463 174..448 181 24.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10076-PA 496 GE10076-PA 1..496 1..496 2490 95 Plus
Dyak\mth2-PA 660 GE21027-PA 278..554 216..472 165 21.4 Plus

FI03364.hyp Sequence

Translation from 330 to 1820

> FI03364.hyp
MLVKTLGAHFAAGQNAKKCSCCALLISLLCVLLLSLNPLPVTSHVTSAGS
STALSSDPNLVLVNKCCEKFEIHVDHECQQVNETDYFQPMFTSYGGEQNR
PVKFKFVIGIPNCGSMQMWPIYHYAGSSDKLVLLDDGRLRHYTNAENEAE
ERHGIQSDYEEDIAGSLEPLYHDYDKGLYCIDKATSSTGEENVLFANICL
ARKEIKWSDSNFLLRKILNPIFHGISLVILLVIAIIYFILPTLRDLVGNI
VTTIAMCLMVSQAADLVRIFTELTSHVSFIVADIILCFSLLAAFFWLNSF
GFYIWKTFRSRNVFLRVTDGRKYCYYSAYAWGCTATMAALAVFAHFFLDA
ESYKQEHMVGEQETIGWLGICIFFAPIACTILVNIFFYVTTRKLINRRTV
YGRIAHKLKANFIMFSLMLLVMSIAWLFLIMSWLQMEGLLYAHIVVNALQ
TPLLLYICVLRQRHVTFLLKKTCCYNEPPSANDWGDELHYMNGNDY*

FI03364.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
mthl5-PA 496 CG6965-PA 1..496 1..496 2630 100 Plus
mthl5-PB 497 CG6965-PB 1..497 1..496 2618 99.8 Plus
mthl2-PB 518 CG17795-PB 185..487 175..471 201 24.5 Plus
mthl15-PC 718 CG31720-PC 346..622 171..434 177 22.1 Plus
mthl10-PB 585 CG17061-PB 246..532 216..473 168 20.8 Plus