Clone FI03417 Report

Search the DGRC for FI03417

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:34
Well:17
Vector:pFlc-1
Associated Gene/TranscriptCG31708-RA
Protein status:FI03417.pep: gold
Sequenced Size:3459

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31708 2008-12-18 5.12 accounting

Clone Sequence Records

FI03417.complete Sequence

3459 bp assembled on 2008-09-19

GenBank Submission: BT044554.1

> FI03417.complete
AGTTTCGCTACGGATTCTGCACGAAGCGGACGCGTTTTATCGGTGTTACA
CTGAAAGATCCCCGGCAAAGGGAAAGTCGTACTCAAGTGTCATGTGATCG
ATGCCAAATTAGAAGCACCTGACTCAATGTGATCGTGTTGAGAAATGACT
TAAAAGTCGAGCTAAAAAACTTAGGTCCACTTGATTATAAAATTTAAAAA
AATACCAAAACTTGTGTGGTAAAAACTATTTAAAAATACATATGCAAGAG
GGCTTTTCAAAATAATTTTTACCAAAATGGCGTTGCTTACAAACAGAACA
TATTAAGTAAATGCCAGAAGGAAATAATCCTGTGAAAAAAATCTAAAAAT
TTGGTAATTGCCACAAGCCAAAAACTGCGATAACAAAACCGTGTGAAAAA
CTTCGTACAAAAGCGAAAACACAAACAAACCCCGCGGCGTTTTAAAAACC
AGTCGGCGGCAGTGAGGTGGTAAAAACTGAGCGAGTAGATCCGAGAGAAT
GCACTTTGGCCAGGAGGCGAGGCCATCATTGGGGCTCCTGGCTGTGGCTG
AGTCGACCGCAACGGCAAGTTGATGTTGCCCCCGTCCTGGCATCTAATTG
GGGCCCTCCTAGTGCTCGCGGCAACAGCGGGGGACTCCACCAACAAGATC
ATCTTGCCGCAGATTCTAAACGGTGGCGGTGGCGGCGGGGGCGTCGGAAC
TGCCCAGGGCAAACATCCGTCTGGATCCAAGACGGTGGCAACTGGAGTGG
TTCCAAACTTCGGTGGAGCAGCTGGCAATGGAGCGGGCGGAGGAGGACCT
GTGGCTGGCAGCGGAACCGGAAGCACCGTGGTCGGCAGCAATGGCGTGAT
TGTGGCCGGAGGCGGGGCCAATGTGCCGACCTCGAATTTAAACATTGTCG
TCGAAGAACCCGAATTTACTGAATACATCGAAAACGTAACTGTACCTGCT
GGACGTAATGTTAAACTCGGTTGCTCCGTGAAAAATCTGGGCTCATATAA
GGTCGCCTGGATGCACTTCGAGCAGTCCGCCATCCTGACCGTTCACAATC
ACGTGATCACGCGCAATCCGCGCATCAGTGTCACGCACGACAAGCACGAC
AGGCACCGCACGTGGTATTTGCACATAAACAATGTGCACGAGGAGGACCG
GGGTCGATATATGTGCCAGATCAATACGGTGACGGCCAAAACGCAGTTTG
GCTACCTAAACGTTGTCGTTCCCCCCAACATCGACGACTCACTGAGCTCC
AGCGATGTGATTGTGCGAGAGGGAGCCAACATTTCGCTGAGATGCCGGGC
CAGCGGTAGTCCCAGACCCATTATCAAATGGAAACGCGACGATAACTCCC
GCATAGCCATCAATAAGAATCACATAGTGAACGAATGGGAGGGCGACACT
CTCGAGATAACTCGCATTTCCCGACTGGACATGGGCGCCTATCTGTGCAT
CGCCTCCAATGGGGTTCCACCCACGGTTTCCAAGCGCATCAAAGTCAGCG
TGGACTTTCCTCCAATGCTGCTTATACCCCATCAGTTGGTTGGTGCTCCC
GAAGGTTTCAACGTCACCATCGAATGCTTCACAGAGGCACATCCCACTTC
TCTGAACTATTGGACACGTGGCGAGGGACCAATCATACACGATTCGCACA
AGTACAAAGTGGAAGCCACAGTCGGATTGCCAGCTTATAAAACCCATATG
AAGTTGACCATCATCAATGTGAGCAGTGGCGATGATGGTATTTACAAATG
TGTGGCCAAGAATCCGAGAGGGGAAACGGATGGCATCATACGACTGTACG
TTTCATATCCTCCAACCACTGCCTCATCGGGTATATACTCCACGGATACG
CATTGGGGGGAAAATGGGATCAACAATAATTATGCTTATGGTGGCCCCGA
CTCCACGCGATCGATTTATGCGCAGGATAAAAATACGCGATATCAATCGA
ATTTGAACGAAATCGGCTTATCTGAACAAAAATCCTTCCTAGATAAGACG
CAGAATCCGTTGTTGGCCAATGGCAACGCCAACGAGGCGGATGCGGAATC
CAACGGGGCCCGGGGTCACAACCCTTCGATGGCCATTGCGTGGCTGTTCG
TCGTCATCGCGACACTGTTGTTAACAATCCGATCTGCGGTTGGTTCTAGC
CATAGCCTAAGTCTATGTTAGTTAACGCAAATCTAGCTTATAGTTATCAG
ATTCAACTACGTATGGGACTAGCTGTAAGGCTTTACGAAACACGTAATGT
TAGCGAATGGCATTAGCGTATGTATGATGTATGTGTAATAAACTAGACCC
TAGTATAAGAGACCCTAATTACAATCCGCCCTTTCCCCTTATACATCACA
AGGTATATACATATATATATATATATACATATTATATATATGAGAGACCA
GGTCCGACTGAGCTCGTTAAGCATATGTATAGCCATCAGCCATCAGTCAT
CAATCACAAGCCCTTTCTCGGGGGTCTATATACACTCATATTCGAATCTA
TTACTAGAAGGTAAGATGAACCAACCAAAGGGTAAATGCAATTTCATTTT
GCTTTCAATGCTGTGCTTCAAACTGAGAAAGTTTCATAGTTATCATATAA
TCTACCACGGTCTATACTTATAGCTATGCATACACATCTACATATATAGT
CGTGCGTTAAACGCTGCTAACACTTGCATATAAGATTACAGACACTTAAT
ATATTATTATGCATATGCCTTAAGGATTGCAAGCTGAAATGCAAATTAAA
CTAAGAAAAATAAGCCATCACACATATCGATCGTGGAAATTGTTTAATTA
GGCCAGATATACCGAATCACGTATAGAGTTTTGTAGATATAGGTAATTAA
CCTTTGAGGACAAATTTCGAATGAATTTATTTATTTTAAGTTATCAATTT
TAGCAGATGAATTATTTGAAAATCCCAAATTCAGTAAATAGAATCAAACA
ATTAGATGGAGTGTTAACTAATAATGTTAAAATATAGATATTATTTCCTG
TTTATCATTAATTTATATAATATGGTCCACAAAGTATTTACACCCAGTCT
CATCGAATAAAATCTTGTTTGTTTATTAAATAGCAACAACCTAATTACGA
TGTAGCTAATAACAGAATAATTAATGTACTAATGTAAAGACAACACGAAA
TGTTAAACATTTAAGCTAAAATAAAGCAAATTTAAATTGTGTTGCTTTAA
AGACAAATTTAATTAGAAAGCAAGAAAGCATGTTGAATGTTGAGAAATAT
AATTGAATTGAACGCAGAGCTATGGACACAATGGAAAAAGGATATACAAA
TATATTACATTATATACAATTATAGACTACGTATATACAAGGAAACACAC
GCATACACGAACTACACTTATGTAACATGTATTTAAGCGTATAAAATGAG
TTGTAACTGAGGCATTAAATTAAATAAAAATCCCAAAAAGACCAAAAAAA
AAAAAAAAA

FI03417.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG31708-RA 3498 CG31708-RA 1..3449 1..3449 17200 99.9 Plus
CG31708.b 4159 CG31708.b 842..4077 214..3449 16135 99.9 Plus
CG31708-RB 3649 CG31708-RB 332..3567 214..3449 16135 99.9 Plus
CG31708.b 4159 CG31708.b 511..725 1..215 1075 100 Plus
CG31708-RB 3649 CG31708-RB 1..215 1..215 1075 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9050508..9052017 3442..1933 7370 99.2 Minus
chr2L 23010047 chr2L 9064978..9065658 894..214 3375 99.7 Minus
chr2L 23010047 chr2L 9059607..9059825 1218..1000 1095 100 Minus
chr2L 23010047 chr2L 9069847..9070061 215..1 1075 100 Minus
chr2L 23010047 chr2L 9058589..9058748 1377..1218 800 100 Minus
chr2L 23010047 chr2L 9054160..9054310 1657..1507 755 100 Minus
chr2L 23010047 chr2L 9053918..9054060 1800..1658 715 100 Minus
chr2L 23010047 chr2L 9058368..9058498 1506..1376 655 100 Minus
chr2L 23010047 chr2L 9052175..9052307 1932..1800 635 98.5 Minus
chr2L 23010047 chr2L 9061305..9061413 1003..895 545 100 Minus
chr2L 23010047 chr2L 6390137..6390338 1201..1000 530 84.2 Minus
chr2L 23010047 chr2L 6384900..6384990 1506..1416 260 85.7 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG31708-RB 1599 CG31708-PB 1..1599 573..2171 7995 100 Plus
CG31708-RA 1599 CG31708-PA 1..1599 573..2171 7995 100 Plus
CG31708-RC 1539 CG31708-PC 1..1363 573..1935 6815 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:24 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG31708-RA 3444 CG31708-RA 3..3444 1..3442 17195 100 Plus
CG31708-RB 3562 CG31708-RB 334..3562 214..3442 16130 100 Plus
CG31708-RC 3384 CG31708-RC 3..1937 1..1935 9675 100 Plus
CG31708-RB 3562 CG31708-RB 3..217 1..215 1075 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG31708-PB 532 CG31708-PB 1..532 573..2168 2434 100 Plus
CG31708-PA 532 CG31708-PA 1..532 573..2168 2434 100 Plus
CG31708-PC 512 CG31708-PC 1..512 573..2168 2303 96.2 Plus
CG42368-PA 467 CG42368-PA 46..465 891..2135 1266 60.7 Plus
CG34391-PE 469 CG34391-PE 38..426 891..2066 815 44.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9051624..9053140 3449..1933 7540 99.8 Minus
2L 23513712 2L 9066080..9066760 894..214 3405 100 Minus
2L 23513712 2L 9060710..9060928 1218..1000 1095 100 Minus
2L 23513712 2L 9070948..9071162 215..1 1075 100 Minus
2L 23513712 2L 9059692..9059851 1377..1218 800 100 Minus
2L 23513712 2L 9055262..9055412 1657..1507 755 100 Minus
2L 23513712 2L 9055020..9055162 1800..1658 715 100 Minus
2L 23513712 2L 9053298..9053430 1932..1800 665 100 Minus
2L 23513712 2L 9059471..9059601 1506..1376 655 100 Minus
2L 23513712 2L 9062398..9062506 1003..895 545 100 Minus
2L 23513712 2L 6391145..6391346 1201..1000 530 84.2 Minus
2L 23513712 2L 6385903..6385993 1506..1416 260 85.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9051624..9053140 3449..1933 7540 99.8 Minus
2L 23513712 2L 9066080..9066760 894..214 3405 100 Minus
2L 23513712 2L 9060710..9060928 1218..1000 1095 100 Minus
2L 23513712 2L 9070948..9071162 215..1 1075 100 Minus
2L 23513712 2L 9059692..9059851 1377..1218 800 100 Minus
2L 23513712 2L 9055262..9055412 1657..1507 755 100 Minus
2L 23513712 2L 9055020..9055162 1800..1658 715 100 Minus
2L 23513712 2L 9053298..9053430 1932..1800 665 100 Minus
2L 23513712 2L 9059471..9059601 1506..1376 655 100 Minus
2L 23513712 2L 9062398..9062506 1003..895 545 100 Minus
2L 23513712 2L 6391145..6391346 1201..1000 530 84.1 Minus
2L 23513712 2L 6385903..6385993 1506..1416 260 85.7 Minus
2L 23513712 2L 6385726..6385817 1615..1524 160 78.2 Minus
Blast to na_te.dros performed on 2014-11-27 11:27:30 has no hits.

FI03417.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:25:39 Download gff for FI03417.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9069879..9070061 1..183 100   Minus
chr2L 9064978..9065658 214..894 99 == Minus
chr2L 9061307..9061413 895..1001 100 <- Minus
chr2L 9059607..9059823 1002..1218 100 <- Minus
chr2L 9058589..9058747 1219..1377 100 <- Minus
chr2L 9058368..9058496 1378..1506 100 <- Minus
chr2L 9054160..9054310 1507..1657 100 <- Minus
chr2L 9053918..9054060 1658..1800 100 <- Minus
chr2L 9052175..9052306 1801..1932 98 <- Minus
chr2L 9050507..9052017 1933..3443 96 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:41:36 Download gff for FI03417.complete
Subject Subject Range Query Range Percent Splice Strand
CG31708-RB 1..1599 573..2171 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:13:06 Download gff for FI03417.complete
Subject Subject Range Query Range Percent Splice Strand
CG31708-RB 1..1599 573..2171 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:42:52 Download gff for FI03417.complete
Subject Subject Range Query Range Percent Splice Strand
CG31708-RA 1..1599 573..2171 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:25:39 Download gff for FI03417.complete
Subject Subject Range Query Range Percent Splice Strand
CG31708-RA 1..1599 573..2171 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:41:36 Download gff for FI03417.complete
Subject Subject Range Query Range Percent Splice Strand
CG31708-RA 1..3442 1..3443 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:13:06 Download gff for FI03417.complete
Subject Subject Range Query Range Percent Splice Strand
CG31708-RA 1..3442 1..3442 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:42:52 Download gff for FI03417.complete
Subject Subject Range Query Range Percent Splice Strand
CG31708-RA 3..3444 1..3442 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-19 19:29:25 Download gff for FI03417.complete
Subject Subject Range Query Range Percent Splice Strand
CG31708-RA 1..3442 1..3443 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:25:39 Download gff for FI03417.complete
Subject Subject Range Query Range Percent Splice Strand
CG31708-RA 3..3444 1..3442 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:25:39 Download gff for FI03417.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9070950..9071162 1..213 100   Minus
2L 9066080..9066760 214..894 100 <- Minus
2L 9062400..9062506 895..1001 100 <- Minus
2L 9060710..9060926 1002..1218 100 <- Minus
2L 9059692..9059850 1219..1377 100 <- Minus
2L 9059471..9059599 1378..1506 100 <- Minus
2L 9055262..9055412 1507..1657 100 <- Minus
2L 9055020..9055162 1658..1800 100 <- Minus
2L 9053298..9053429 1801..1932 100 <- Minus
2L 9051630..9053140 1933..3443 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:42:52 Download gff for FI03417.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9070950..9071162 1..213 100   Minus
arm_2L 9066080..9066760 214..894 100 <- Minus
arm_2L 9062400..9062506 895..1001 100 <- Minus
arm_2L 9060710..9060926 1002..1218 100 <- Minus
arm_2L 9059692..9059850 1219..1377 100 <- Minus
arm_2L 9059471..9059599 1378..1506 100 <- Minus
arm_2L 9055262..9055412 1507..1657 100 <- Minus
arm_2L 9055020..9055162 1658..1800 100 <- Minus
arm_2L 9053298..9053429 1801..1932 100 <- Minus
arm_2L 9051630..9053140 1933..3443 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:43:41 Download gff for FI03417.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9070950..9071162 1..213 100   Minus
2L 9066080..9066760 214..894 100 <- Minus
2L 9062400..9062506 895..1001 100 <- Minus
2L 9060710..9060926 1002..1218 100 <- Minus
2L 9059692..9059850 1219..1377 100 <- Minus
2L 9059471..9059599 1378..1506 100 <- Minus
2L 9055262..9055412 1507..1657 100 <- Minus
2L 9055020..9055162 1658..1800 100 <- Minus
2L 9053298..9053429 1801..1932 100 <- Minus
2L 9051630..9053140 1933..3443 99 <- Minus

FI03417.pep Sequence

Translation from 572 to 2170

> FI03417.pep
MLPPSWHLIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPS
GSKTVATGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGAN
VPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFE
QSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQI
NTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPI
IKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPP
TVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRG
EGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRG
ETDGIIRLYVSYPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYA
QDKNTRYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNGARGHN
PSMAIAWLFVVIATLLLTIRSAVGSSHSLSLC*

FI03417.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 19:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22082-PA 499 GF22082-PA 1..499 1..532 2260 85 Plus
Dana\GF21699-PA 655 GF21699-PA 70..373 113..417 789 51 Plus
Dana\GF22310-PA 554 GF22310-PA 19..316 112..409 750 47 Plus
Dana\GF14311-PA 396 GF14311-PA 1..288 122..414 748 49.1 Plus
Dana\GF14310-PA 570 GF14310-PA 100..390 113..409 745 48.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 19:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24038-PA 537 GG24038-PA 1..537 1..532 2601 95.4 Plus
Dere\GG23628-PA 439 GG23628-PA 14..319 106..411 1268 74.2 Plus
Dere\GG10188-PA 672 GG10188-PA 74..377 113..417 789 51.3 Plus
Dere\GG24289-PA 606 GG24289-PA 132..422 113..409 757 48.8 Plus
Dere\GG24291-PA 446 GG24291-PA 8..316 105..414 750 46.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 19:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13645-PA 518 GH13645-PA 1..515 1..525 2218 81.2 Plus
Dgri\GH10989-PA 436 GH10989-PA 2..395 74..470 1306 64.6 Plus
Dgri\GH13877-PA 391 GH13877-PA 26..329 113..417 790 51 Plus
Dgri\GH10699-PA 403 GH10699-PA 8..305 112..414 789 49.8 Plus
Dgri\GH24041-PA 569 GH24041-PA 41..338 112..409 770 48 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG31708-PB 532 CG31708-PB 1..532 1..532 2813 100 Plus
CG31708-PA 532 CG31708-PA 1..532 1..532 2813 100 Plus
CG31708-PC 512 CG31708-PC 1..512 1..532 2682 96.2 Plus
CG42368-PA 467 CG42368-PA 15..465 72..521 1320 59 Plus
CG34391-PE 469 CG34391-PE 38..426 107..498 829 45.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 19:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11934-PA 527 GI11934-PA 1..527 1..532 2145 78.6 Plus
Dmoj\GI17503-PA 863 GI17503-PA 1..215 147..361 942 78.1 Plus
Dmoj\GI13190-PA 467 GI13190-PA 12..308 107..409 816 51.3 Plus
Dmoj\GI11247-PA 470 GI11247-PA 43..343 109..414 793 50 Plus
Dmoj\GI10093-PA 691 GI10093-PA 67..372 111..417 792 50.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 19:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25539-PA 523 GL25539-PA 1..518 1..529 2142 83.4 Plus
Dper\GL26263-PA 958 GL26263-PA 5..288 83..365 1123 71.8 Plus
Dper\GL26643-PA 462 GL26643-PA 49..346 112..414 764 48.8 Plus
Dper\GL26641-PA 603 GL26641-PA 128..418 113..409 757 48.5 Plus
Dper\GL15787-PA 333 GL15787-PA 38..278 113..352 648 49.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 19:50:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28029-PA 476 GA28029-PA 1..471 1..529 1839 74.7 Plus
Dpse\GA28099-PA 956 GA28099-PA 5..286 83..363 1122 72.3 Plus
Dpse\GA23467-PA 453 GA23467-PA 12..332 107..433 832 49.7 Plus
Dpse\GA16498-PA 684 GA16498-PA 80..383 113..417 792 51 Plus
Dpse\GA29001-PA 462 GA29001-PA 49..346 112..414 767 48.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 19:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12550-PA 512 GM12550-PA 1..512 1..532 2505 95.1 Plus
Dsec\GM17944-PA 948 GM17944-PA 12..281 93..361 1116 74.1 Plus
Dsec\GM25389-PA 675 GM25389-PA 74..377 113..417 790 51.3 Plus
Dsec\GM18009-PA 449 GM18009-PA 8..312 105..414 765 47.1 Plus
Dsec\GM12720-PA 550 GM12720-PA 41..338 112..409 757 47.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 19:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22365-PA 512 GD22365-PA 1..512 1..532 2494 95.3 Plus
Dsim\GD22581-PA 948 GD22581-PA 12..281 93..361 1117 74.1 Plus
Dsim\GD22051-PA 675 GD22051-PA 74..377 113..417 791 51.3 Plus
Dsim\GD22639-PA 514 GD22639-PA 130..420 113..409 754 48.8 Plus
Dsim\GD16325-PA 648 GD16325-PA 139..436 112..409 747 47 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 19:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14067-PA 518 GJ14067-PA 1..518 1..532 2218 81.3 Plus
Dvir\GJ15194-PA 427 GJ15194-PA 15..385 108..470 1312 69 Plus
Dvir\GJ18366-PA 670 GJ18366-PA 62..367 111..417 792 50.6 Plus
Dvir\GJ12356-PA 423 GJ12356-PA 43..343 109..414 782 49.3 Plus
Dvir\GJ15333-PA 556 GJ15333-PA 41..338 112..409 764 48 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 19:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23705-PA 528 GK23705-PA 1..486 1..496 2209 87.1 Plus
Dwil\GK15358-PA 952 GK15358-PA 6..287 88..363 1138 73 Plus
Dwil\GK24547-PA 614 GK24547-PA 61..364 113..417 790 51 Plus
Dwil\GK15428-PA 950 GK15428-PA 546..843 112..414 771 49.2 Plus
Dwil\GK16718-PA 551 GK16718-PA 41..338 112..409 752 47.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 19:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10621-PA 535 GE10621-PA 1..535 1..532 2609 96.4 Plus
Dyak\GE18447-PA 279 GE18447-PA 9..279 93..362 1113 74.2 Plus
Dyak\GE11503-PA 661 GE11503-PA 74..377 113..417 787 51.3 Plus
Dyak\GE18986-PA 422 GE18986-PA 8..312 105..414 764 47.1 Plus
Dyak\GE18984-PA 573 GE18984-PA 99..389 113..409 755 48.8 Plus

FI03417.hyp Sequence

Translation from 572 to 2170

> FI03417.hyp
MLPPSWHLIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPS
GSKTVATGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGAN
VPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFE
QSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQI
NTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPI
IKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPP
TVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRG
EGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRG
ETDGIIRLYVSYPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYA
QDKNTRYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNGARGHN
PSMAIAWLFVVIATLLLTIRSAVGSSHSLSLC*

FI03417.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG31708-PB 532 CG31708-PB 1..532 1..532 2813 100 Plus
CG31708-PA 532 CG31708-PA 1..532 1..532 2813 100 Plus
CG31708-PC 512 CG31708-PC 1..512 1..532 2682 96.2 Plus
CG42368-PA 467 CG42368-PA 15..465 72..521 1320 59 Plus
CG34391-PE 469 CG34391-PE 38..426 107..498 829 45.1 Plus