Clone FI03431 Report

Search the DGRC for FI03431

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:34
Well:31
Vector:pFlc-1
Associated Gene/TranscriptCG15239-RA
Protein status:FI03431.pep: gold
Sequenced Size:2010

Clone Sequence Records

FI03431.complete Sequence

2010 bp assembled on 2009-12-14

GenBank Submission: BT120043.1

> FI03431.complete
AGTCGAGTTCCGCGTCCCCGAGCGTTGAGTTCAGTCTTATAAAGAGCAGC
AGCATCCGATTTCCTGGCAGAGCGGGAAAACCAATCGTCACGCGCGCCAA
GCCAATTTCAAAACTATTTTCCAATATTATTTATTTTTTTTTTTTTTTGC
CACACACGGAGTGCTATAGTTTTTTTGTTGTGTTCCAAGTGCAATACGGA
AGTGTGTCTGACCAGCAACTGGAGTTACAGCGCACAGGAGAGCGGGCTAG
AAGGATAGCAGGATAACTAGGATAACTGGATAACAGGATAAACCTACTTA
TAGATTCGCAAATCAAGATGACCAGCTCGAGGAATATGCTACTGATGCTG
CTCCTGGTGGCCAGTGCCTCCATACTTCAACTGGAGGCCAAGACCGTGTT
CCGGCGCACAGACAAGATATCGGAGAACTTCAAGCAGTTAGATTTGCCGC
CAGAGGAGATCGATCCCAATGTGGCGCCACCGGAATCGGAGCCGCCCAAG
GTGGAGGATGTCGCTGATGTGGCGGATGAGGTGGTCAATGCCGTGTCGCC
TGCTTCGTCCATCGACGAGAGTGCCAATGAGATAGCCAGCGGTGATGTGG
ATACCCCGAATGCTGCAGCTTCCGTTGCAGAAGCTGTCGCCCCAGCCGCT
GCCGTTCCCGAGGTCGCAGAGGCAGCTGCTCCGGCGGTGGCCACCACTCT
AGCGGCCAAGCCTACCACTGCACCGACCACCGCCAAGCCGGAGAATCCCA
TCAGCAAGTTCTGCAAGTGCTCGGAGAGCCACTGCGACTGCTGCCGGAAG
TTCGGATTGCCATTGCTGCCCAGCGGACCTGGCTGCGCCAAGATCGCCTA
TGTGGGCAACGACGAGATGAGCGTGTCCCTCAAATACGGTGGCATCACCT
TGGCCTCTCGTCGCATCTCCAGCAAGCGGGCTCGCCCCATTTGCGTGGGC
CTGCCCGGCGGCTACTCCAAGTTCTGCGGCAAGGTCTATGGTCTGTCCCG
TTCCAAGGAGTCCAAGGACTTCAAGGCATGCCTGGCCTTTGAACTGCGCT
CCGACGACGAGGTGGAGGCCTCCCTGCGCGTCTCCTGTTTCAAGTTTGGA
CCGGAAGGAGTCCGGGTGGCCGAGGCGGAGCCGTTGCCTGTGAAGCCCAG
TTCGGATGACGATGATGACGACGATGATGACCTCTTTGGATTTGCCGCTG
GTGGCGACGATGACGAGGATGAGGAGGACGACTATGACAGCGACAACGAT
ACGGATGCGGATGCCGATGACGACGATGACACCGAGGACTATGCCGATGA
TGACGAGGCCGAGGCGCCCGAGGATGCTGATTACGGTGGCTTTAGTTTGG
CCGGACTTCTGGACGAGCTCGACGATGACGACGATGAGAAGCCGGTTAAG
AAGCCAGCGGCTGCGGCTGCGTCAGCGGCTGCTGACCAAACCCGCGAGCA
TGTAATTGCCGATGGCCAGGTGACCGCGACTACGACGAACGGCGACCAGG
TGCAGAGCAAGGACGATACGGGAGCTCCTGCCGCTGGCGAGGCTGTTGCA
GCTGCTGCACCTGCTGCGCCTGCTGCTCCTCTTGCTGCTCCTGCAGCCGC
AGCACCGATTGAGGGAGAAGTGGCCGCAGCGGTGACACCGGCTACCACAG
CTGCCGCCGATGAAGACTCCACCACGCCCAAGTCCAAGAAGTCCAAGAAG
GCGAAAAAGAACAAGAAGAAGAAGGCCGCCGCAGAGGCGACGGATGAGAC
TGGATTCGCCTACGAGCTCCTCAATGGCATCCTGGATTTTTTCAACTGAG
CGGCCAGCGCGAGTTTGCCAACATGCTGGGCAATAGTGTAAATACCTTGT
ACCGCCGCAGCTGGTCGACACAAATTTAGTTCATAGTTCATAGGTCGTAG
CGCTTAAGGGCCCCCCGAAATTTCACATATTTATTTCAACTTCGATAATT
TATTTTAAATTTATAACGAATAAAAATGAAAAATGTACTACCCAAAAAAA
AAAAAAAAAA

FI03431.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG15239.a 2682 CG15239.a 450..2443 1..1994 9970 100 Plus
CG15239-RA 2166 CG15239-RA 127..2120 1..1994 9970 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 3781947..3782846 298..1197 4395 99.2 Plus
chrX 22417052 chrX 3782994..3783790 1197..1993 3805 98.5 Plus
chrX 22417052 chrX 3777504..3777806 1..303 1500 99.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG15239-RA 1482 CG15239-PA 1..1482 318..1799 7410 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:27 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG15239-RA 1997 CG15239-RA 5..1997 1..1993 9965 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG15239-PA 493 CG15239-PA 1..279 318..1154 1025 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3888643..3889542 298..1197 4485 99.9 Plus
X 23542271 X 3889690..3890487 1197..1994 3990 100 Plus
X 23542271 X 3884172..3884474 1..303 1515 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 3896741..3897640 298..1197 4485 99.8 Plus
X 23527363 X 3897788..3898585 1197..1994 3990 100 Plus
X 23527363 X 3892270..3892572 1..303 1515 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:39:35 has no hits.

FI03431.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:40:41 Download gff for FI03431.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 3783110..3783320 1313..1523 97 == Plus
chrX 3781951..3782846 302..1197 99 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-14 11:37:43 Download gff for FI03431.complete
Subject Subject Range Query Range Percent Splice Strand
CG15239-RA 1..1482 318..1799 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:28:44 Download gff for FI03431.complete
Subject Subject Range Query Range Percent Splice Strand
CG15239-RA 1..1482 318..1799 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:34:36 Download gff for FI03431.complete
Subject Subject Range Query Range Percent Splice Strand
CG15239-RA 1..1482 318..1799 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:40:41 Download gff for FI03431.complete
Subject Subject Range Query Range Percent Splice Strand
CG15239-RA 1..1482 318..1799 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-14 11:37:43 Download gff for FI03431.complete
Subject Subject Range Query Range Percent Splice Strand
CG15239-RA 1..1993 1..1993 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:28:43 Download gff for FI03431.complete
Subject Subject Range Query Range Percent Splice Strand
CG15239-RA 1..1993 1..1993 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:34:36 Download gff for FI03431.complete
Subject Subject Range Query Range Percent Splice Strand
CG15239-RA 1..1993 1..1993 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:40:41 Download gff for FI03431.complete
Subject Subject Range Query Range Percent Splice Strand
CG15239-RA 5..1997 1..1993 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:40:41 Download gff for FI03431.complete
Subject Subject Range Query Range Percent Splice Strand
X 3889691..3890486 1198..1993 100   Plus
X 3888649..3889542 304..1197 100 -> Plus
X 3884172..3884474 1..303 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:34:36 Download gff for FI03431.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3783724..3784519 1198..1993 100   Plus
arm_X 3782682..3783575 304..1197 100 -> Plus
arm_X 3778205..3778507 1..303 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:14:28 Download gff for FI03431.complete
Subject Subject Range Query Range Percent Splice Strand
X 3897789..3898584 1198..1993 100   Plus
X 3896747..3897640 304..1197 100 -> Plus
X 3892270..3892572 1..303 100 -> Plus

FI03431.pep Sequence

Translation from 317 to 1798

> FI03431.pep
MTSSRNMLLMLLLVASASILQLEAKTVFRRTDKISENFKQLDLPPEEIDP
NVAPPESEPPKVEDVADVADEVVNAVSPASSIDESANEIASGDVDTPNAA
ASVAEAVAPAAAVPEVAEAAAPAVATTLAAKPTTAPTTAKPENPISKFCK
CSESHCDCCRKFGLPLLPSGPGCAKIAYVGNDEMSVSLKYGGITLASRRI
SSKRARPICVGLPGGYSKFCGKVYGLSRSKESKDFKACLAFELRSDDEVE
ASLRVSCFKFGPEGVRVAEAEPLPVKPSSDDDDDDDDDLFGFAAGGDDDE
DEEDDYDSDNDTDADADDDDDTEDYADDDEAEAPEDADYGGFSLAGLLDE
LDDDDDEKPVKKPAAAAASAAADQTREHVIADGQVTATTTNGDQVQSKDD
TGAPAAGEAVAAAAPAAPAAPLAAPAAAAPIEGEVAAAVTPATTAAADED
STTPKSKKSKKAKKNKKKKAAAEATDETGFAYELLNGILDFFN*

FI03431.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21183-PA 520 GF21183-PA 53..520 14..493 1083 69.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18680-PA 487 GG18680-PA 1..487 1..493 1475 86.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17613-PA 497 GH17613-PA 33..497 9..493 938 54.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG15239-PA 493 CG15239-PA 1..493 1..493 2515 100 Plus
ect-PE 548 CG6611-PE 46..229 275..446 211 34.8 Plus
ect-PD 280 CG6611-PD 46..269 275..472 209 31.7 Plus
ect-PB 581 CG6611-PB 46..216 275..433 204 35.7 Plus
ect-PA 581 CG6611-PA 46..216 275..433 204 35.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16481-PA 469 GI16481-PA 132..469 142..493 744 65 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14762-PA 278 GL14762-PA 1..268 1..260 858 67.8 Plus
Dper\GL14764-PA 201 GL14764-PA 62..201 333..493 197 58.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13592-PA 486 GA13592-PA 1..486 1..493 1036 63.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12315-PA 470 GM12315-PA 1..470 1..493 1577 90.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:57:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16661-PA 482 GD16661-PA 1..482 1..493 1544 91.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16025-PA 446 GJ16025-PA 22..446 22..493 921 57.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10229-PA 445 GK10229-PA 6..445 7..493 1012 60.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16320-PA 473 GE16320-PA 1..473 1..493 1604 88.1 Plus

FI03431.hyp Sequence

Translation from 317 to 1798

> FI03431.hyp
MTSSRNMLLMLLLVASASILQLEAKTVFRRTDKISENFKQLDLPPEEIDP
NVAPPESEPPKVEDVADVADEVVNAVSPASSIDESANEIASGDVDTPNAA
ASVAEAVAPAAAVPEVAEAAAPAVATTLAAKPTTAPTTAKPENPISKFCK
CSESHCDCCRKFGLPLLPSGPGCAKIAYVGNDEMSVSLKYGGITLASRRI
SSKRARPICVGLPGGYSKFCGKVYGLSRSKESKDFKACLAFELRSDDEVE
ASLRVSCFKFGPEGVRVAEAEPLPVKPSSDDDDDDDDDLFGFAAGGDDDE
DEEDDYDSDNDTDADADDDDDTEDYADDDEAEAPEDADYGGFSLAGLLDE
LDDDDDEKPVKKPAAAAASAAADQTREHVIADGQVTATTTNGDQVQSKDD
TGAPAAGEAVAAAAPAAPAAPLAAPAAAAPIEGEVAAAVTPATTAAADED
STTPKSKKSKKAKKNKKKKAAAEATDETGFAYELLNGILDFFN*

FI03431.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:31:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG15239-PA 493 CG15239-PA 1..493 1..493 2515 100 Plus
ect-PE 548 CG6611-PE 46..229 275..446 211 34.8 Plus
ect-PD 280 CG6611-PD 46..269 275..472 209 31.7 Plus
ect-PB 581 CG6611-PB 46..216 275..433 204 35.7 Plus
ect-PA 581 CG6611-PA 46..216 275..433 204 35.7 Plus