Clone FI03455 Report

Search the DGRC for FI03455

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:34
Well:55
Vector:pFlc-1
Associated Gene/TranscriptCG30349-RA
Protein status:FI03455.pep: gold
Sequenced Size:2027

Clone Sequence Records

FI03455.complete Sequence

2027 bp assembled on 2009-12-14

GenBank Submission: BT120044.1

> FI03455.complete
AAGTGCGACGAGTGTGAGCCGATGTAAACACTAGCCTTAGCGCCCATCTC
TAATTCAAAACATAAAAAACGATGTCGCTGGGCAAGAAGCACGTGTTGGG
ATTTTCGCCCAATGGTGGCCAACTATTTGCCTCGGTGGACGAGTCGGGAG
TTCTGCGGATATGGAACACAGAGACGAACACGCTGTATCAGGAGTTTACG
CCCAATCTACAGTTATCCGGGTCGTGCACAGCTCTCACGTGGGTTTTGGT
GGCCGGTTCCCGGCCCAAGAAGTCGCGGAAGAGCCTCCAGGCACAGGATG
CAGCCGGTGATCAGCTTCACATTGCTCTGGGAACGTACAAGGGCTCAGTG
GTTATATACTCATTAGCCGAGGGAAAGATTTCTCGAACGCTCAGTGGCGA
CAGCCATGATGGACCAGTGACCTCAATTACAAATGACAACGCTGGCCACC
TATACACTGTGGGTGCCGATTGTAGGGTTGTTGTTTGGTCCTTGACGGAC
GAGCGCTCCATCGCCGAATGGCAAGTGGGACCCGAGAAGCCCCAAAATAT
AGTCTACCTTCAGAAAAGTGGCACCTTGGCCATTGGCTACCGACAGCTGA
AGGTGTACGATATCAAGACAAAGGAGCTGGTGGAAACGTTCACCGGCCAC
TCGGGCGAAATAAACACAATCAGCAGCGTGGCGAGCACAGATGGCACTGA
ATTCGTTTTGACCACCGCGAAGATGGAGCGCGTAATCTGCTTCTGGAAGA
TCGACAAGAAGGGCAAGAACAAAGCCTCCGCCTGCACGCTCCTCATGGAG
GACTTGGCCTACTGTCTAACCAGCGAAGTGCGCGACGATGGTCAGCTACG
TGTGGCCAGTGTTACCCGCAATGGCATCATACACATTTACCTGTTGAATG
TGAACAGTTTATCCGCAGAGAAGTTTGTGAAGCCCAAGGTTTCGCTGCAG
ATCGTTTCCGATGGCGCCGAAACAGTGGAACCACTTCTAGCCGTGGCGGC
CCACTTTGTGACAGACTCAAATCGCTCCCACGAAATCCTCTTTGGCTACG
GAAGTCGCCAACAGCTGCAGTTTGAACGTTTTACGCCCAACTATGGCGAG
AAACTAAACGTTATTGTGCGCGCCGATCCCAAAAAGCTCTATGCGAAAAA
GAAGGGAAAGGAGCAGCCGGGCTACCAGGCCGCCACCAAGGTCCAGAAGC
CCATTGTAAACCAAAAAAATGTGGAGTACAACAGCGCCCTGCCCATCTCG
CAGAAGAAAGTGCAAAACGAAGTGCCCATGGAAGCCCGACTAGAACATCT
TAAAATTCAAGGAACCAAACTGAGTGGCGGCAAGTTGTTGACGCAGAGCA
AAACGCAGCTGCTAATGCAGGCATTACACAGCAAGGATCAGGCGATGATA
CAAGCCGTTCTGAGCACTCAGGATCCAGAGACGATACAGTTGACCTTGGA
TCGGCTACCGCTCGATTATGTCAATCCCCTGGTCAACGAACTTTCCATCC
TGCTGCAAGGAAAGCACGCGAGTGTCCGCTCCGCCCTGCGTTGGCTGCAC
GCACTGACCTCCACCCACACTAGTGTCTTGATGTCCGAGGACAAGGAGGC
TTTGCGCGAAAAACTAGCCGTTTGCCTCGGCGTGGCGGAGCAGCGCATGC
ACTGTCTATCGGAAGCTTTGCAAATAACCGGGCGAGTCAACCTGATAATT
AACCAGATGAAACGCAACGCGGACAATCATCTCAACGATAACAAAGCCCT
GATCCTGGACGAAGATCCAGATGAGCCCGATCCCGAAGCAGAAACGAACT
GGAGCGATCTGGAGGAGGATCAGCCAGGCAGTCCGAAGAGCCCATTGGAA
GACGAGCTGGTGGCCGACGACGACCTGGCGACCGACGATGGTAACGCCGA
CGCAGACACAGACTCTGACGTATCCATGGATTAGACAGTCTACCCGTAAT
TTAAGCTTAAATGCAATTCCCTTGTTGTTGCGCCGCGAGAAAATAAATTA
GCATTTTTTTCCAAAAAAAAAAAAAAA

FI03455.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG30349-RA 2120 CG30349-RA 100..2114 1..2015 10075 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4795499..4796030 376..907 2645 99.8 Plus
chr2R 21145070 chr2R 4796082..4796572 904..1394 2440 99.8 Plus
chr2R 21145070 chr2R 4795071..4795447 1..377 1885 100 Plus
chr2R 21145070 chr2R 4798192..4798436 1768..2012 1225 100 Plus
chr2R 21145070 chr2R 4796811..4796962 1521..1672 760 100 Plus
chr2R 21145070 chr2R 4796628..4796756 1394..1522 645 100 Plus
chr2R 21145070 chr2R 4798038..4798135 1673..1770 490 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG30349-RA 1863 CG30349-PA 1..1863 72..1934 9315 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:30 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG30349-RA 2014 CG30349-RA 3..2014 1..2012 10060 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG30349-PA 620 CG30349-PA 1..592 72..1847 2955 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8907948..8908479 376..907 2660 100 Plus
2R 25286936 2R 8908531..8909021 904..1394 2455 100 Plus
2R 25286936 2R 8907520..8907896 1..377 1885 100 Plus
2R 25286936 2R 8910641..8910888 1768..2015 1240 100 Plus
2R 25286936 2R 8909260..8909411 1521..1672 760 100 Plus
2R 25286936 2R 8909077..8909205 1394..1522 645 100 Plus
2R 25286936 2R 8910487..8910584 1673..1770 490 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8909147..8909678 376..907 2660 100 Plus
2R 25260384 2R 8909730..8910220 904..1394 2455 100 Plus
2R 25260384 2R 8908719..8909095 1..377 1885 100 Plus
2R 25260384 2R 8911840..8912087 1768..2015 1240 100 Plus
2R 25260384 2R 8910459..8910610 1521..1672 760 100 Plus
2R 25260384 2R 8910276..8910404 1394..1522 645 100 Plus
2R 25260384 2R 8911686..8911783 1673..1770 490 100 Plus
Blast to na_te.dros performed on 2014-11-27 09:43:36 has no hits.

FI03455.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:27:18 Download gff for FI03455.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4798195..4798436 1771..2012 100   Plus
chr2R 4798038..4798135 1673..1770 100 -> Plus
chr2R 4796813..4796962 1523..1672 100 -> Plus
chr2R 4796628..4796756 1394..1522 100 -> Plus
chr2R 4796086..4796571 908..1393 99 -> Plus
chr2R 4795501..4796030 378..907 99 -> Plus
chr2R 4795071..4795447 1..377 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-14 11:37:25 Download gff for FI03455.complete
Subject Subject Range Query Range Percent Splice Strand
CG30349-RA 1..1863 72..1934 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:28:45 Download gff for FI03455.complete
Subject Subject Range Query Range Percent Splice Strand
CG30349-RA 1..1863 72..1934 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:32:28 Download gff for FI03455.complete
Subject Subject Range Query Range Percent Splice Strand
CG30349-RA 1..1863 72..1934 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:27:18 Download gff for FI03455.complete
Subject Subject Range Query Range Percent Splice Strand
CG30349-RA 1..1863 72..1934 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-14 11:37:24 Download gff for FI03455.complete
Subject Subject Range Query Range Percent Splice Strand
CG30349-RA 1..2012 1..2012 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:28:45 Download gff for FI03455.complete
Subject Subject Range Query Range Percent Splice Strand
CG30349-RA 1..2012 1..2012 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:32:28 Download gff for FI03455.complete
Subject Subject Range Query Range Percent Splice Strand
CG30349-RA 3..2014 1..2012 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:18 Download gff for FI03455.complete
Subject Subject Range Query Range Percent Splice Strand
CG30349-RA 3..2014 1..2012 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:27:18 Download gff for FI03455.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8910644..8910885 1771..2012 100   Plus
2R 8910487..8910584 1673..1770 100 -> Plus
2R 8909262..8909411 1523..1672 100 -> Plus
2R 8909077..8909205 1394..1522 100 -> Plus
2R 8908535..8909020 908..1393 100 -> Plus
2R 8907950..8908479 378..907 100 -> Plus
2R 8907520..8907896 1..377 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:32:28 Download gff for FI03455.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4798149..4798390 1771..2012 100   Plus
arm_2R 4797992..4798089 1673..1770 100 -> Plus
arm_2R 4796767..4796916 1523..1672 100 -> Plus
arm_2R 4796582..4796710 1394..1522 100 -> Plus
arm_2R 4796040..4796525 908..1393 100 -> Plus
arm_2R 4795455..4795984 378..907 100 -> Plus
arm_2R 4795025..4795401 1..377 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:14:29 Download gff for FI03455.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8911843..8912084 1771..2012 100   Plus
2R 8911686..8911783 1673..1770 100 -> Plus
2R 8910461..8910610 1523..1672 100 -> Plus
2R 8910276..8910404 1394..1522 100 -> Plus
2R 8909734..8910219 908..1393 100 -> Plus
2R 8909149..8909678 378..907 100 -> Plus
2R 8908719..8909095 1..377 100 -> Plus

FI03455.pep Sequence

Translation from 71 to 1933

> FI03455.pep
MSLGKKHVLGFSPNGGQLFASVDESGVLRIWNTETNTLYQEFTPNLQLSG
SCTALTWVLVAGSRPKKSRKSLQAQDAAGDQLHIALGTYKGSVVIYSLAE
GKISRTLSGDSHDGPVTSITNDNAGHLYTVGADCRVVVWSLTDERSIAEW
QVGPEKPQNIVYLQKSGTLAIGYRQLKVYDIKTKELVETFTGHSGEINTI
SSVASTDGTEFVLTTAKMERVICFWKIDKKGKNKASACTLLMEDLAYCLT
SEVRDDGQLRVASVTRNGIIHIYLLNVNSLSAEKFVKPKVSLQIVSDGAE
TVEPLLAVAAHFVTDSNRSHEILFGYGSRQQLQFERFTPNYGEKLNVIVR
ADPKKLYAKKKGKEQPGYQAATKVQKPIVNQKNVEYNSALPISQKKVQNE
VPMEARLEHLKIQGTKLSGGKLLTQSKTQLLMQALHSKDQAMIQAVLSTQ
DPETIQLTLDRLPLDYVNPLVNELSILLQGKHASVRSALRWLHALTSTHT
SVLMSEDKEALREKLAVCLGVAEQRMHCLSEALQITGRVNLIINQMKRNA
DNHLNDNKALILDEDPDEPDPEAETNWSDLEEDQPGSPKSPLEDELVADD
DLATDDGNADADTDSDVSMD*

FI03455.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12389-PA 624 GF12389-PA 1..623 1..620 2644 82.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:57:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23394-PA 626 GG23394-PA 1..626 1..620 3097 95.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23108-PA 626 GH23108-PA 1..583 1..583 2095 66.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG30349-PA 620 CG30349-PA 1..620 1..620 3168 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18931-PA 638 GI18931-PA 1..634 1..620 2129 63.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11675-PA 629 GL11675-PA 1..588 1..582 2429 79.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15777-PA 629 GA15777-PA 1..588 1..582 2431 79.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21075-PA 566 GM21075-PA 1..564 1..618 2422 79.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10611-PA 533 GD10611-PA 1..533 1..534 2702 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21303-PA 632 GJ21303-PA 1..582 1..582 2191 69.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21367-PA 653 GK21367-PA 1..587 1..583 2222 72.4 Plus
Dwil\GK10631-PA 638 GK10631-PA 261..632 1..375 1354 68.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19236-PA 626 GE19236-PA 1..626 1..620 3033 92.8 Plus

FI03455.hyp Sequence

Translation from 71 to 1933

> FI03455.hyp
MSLGKKHVLGFSPNGGQLFASVDESGVLRIWNTETNTLYQEFTPNLQLSG
SCTALTWVLVAGSRPKKSRKSLQAQDAAGDQLHIALGTYKGSVVIYSLAE
GKISRTLSGDSHDGPVTSITNDNAGHLYTVGADCRVVVWSLTDERSIAEW
QVGPEKPQNIVYLQKSGTLAIGYRQLKVYDIKTKELVETFTGHSGEINTI
SSVASTDGTEFVLTTAKMERVICFWKIDKKGKNKASACTLLMEDLAYCLT
SEVRDDGQLRVASVTRNGIIHIYLLNVNSLSAEKFVKPKVSLQIVSDGAE
TVEPLLAVAAHFVTDSNRSHEILFGYGSRQQLQFERFTPNYGEKLNVIVR
ADPKKLYAKKKGKEQPGYQAATKVQKPIVNQKNVEYNSALPISQKKVQNE
VPMEARLEHLKIQGTKLSGGKLLTQSKTQLLMQALHSKDQAMIQAVLSTQ
DPETIQLTLDRLPLDYVNPLVNELSILLQGKHASVRSALRWLHALTSTHT
SVLMSEDKEALREKLAVCLGVAEQRMHCLSEALQITGRVNLIINQMKRNA
DNHLNDNKALILDEDPDEPDPEAETNWSDLEEDQPGSPKSPLEDELVADD
DLATDDGNADADTDSDVSMD*

FI03455.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG30349-PA 620 CG30349-PA 1..620 1..620 3168 100 Plus