Clone FI03459 Report

Search the DGRC for FI03459

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:34
Well:59
Vector:pFlc-1
Associated Gene/TranscriptACXD-RA
Protein status:FI03459.pep: gold
Sequenced Size:4125

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
ACXD 2008-12-18 5.12 accounting

Clone Sequence Records

FI03459.complete Sequence

4125 bp assembled on 2008-11-12

GenBank Submission: BT053678.1

> FI03459.complete
AGTTGGTCGCAGCAGTTGGTTGGAGTCGGTCGCGTGTGTTGATAGCAGCT
CCGGCGGGCAATTAAGTCGGACGGAATCGAATCGGGGCGAGCGCTTATCG
CGGCAAAAGAGTAATTTGTGATACCTGTCCGCCGTGTATTGGCTTGTTGG
AGCGCAACGCGCTTAAGTGGTGTTAATTTTTTATTAATTATTATCGTATT
TATTACCCAACGAAAGTGAAGTGCGAAATCGGTCGCCTCAAGTGCCCGGC
CGTACGTGCAAAGCCCGTAAATAAATTACACAGCCATATAGCCCTGATCC
TTACCTCTACACTCGCTCTCGCCCACCGCAGCTGATAATGCAGACGAATT
CCGCCTGATCGATTCCCATTCCCATTTCGATTGCGATTTGGAGTGCGAGT
GCGGGCGAAATAGGCAGCCAGCCTCTGATTCTGAGTAGCTGCCACCGAAA
ATGAGCCCGCCACATTGATCATCTGATCTCCCATCCACCCAATCCAATCT
GAACTGAACTGAACTGGCGCCATCATGGACTCCTACTTCGACTCGGCCAT
CGAGTACAATCGATCCAACCCCATCAGCCTGGCCAGGACCAGCAGCCAGG
CCCAAACCGTGCAGAACGAGAAGAACTGGGAGTGGTCGTACCTTGTGAGA
AAATGTCGCAACCTGGAGCTGGAGGACTCGTACGACCTATACATGCGTCG
CCTGCGCGTCGGCTACCTGTCGCTGTTCATCTTCATCCACGTGGCGGTGA
CGGTGATCCACACGCTGCTGCTGCTGACCACGCCGGAGATCAAGTACGTG
TACGTGGACATGGTGGCCTACATGTGCTCCGGCCTGGTCATCTGGGTGGT
GCTGGGCGTGAACTTTCGCAGCGAGCTGGTGAGCAAGCACGGCTGGGTGG
TCTACGCCACCTCCTGGCTGGCGGTGTGTGTAATGGTCCTGATGGACATC
GGACTGAATGTTTACCACGCCACCAGCCACAACGACATCCTGAATCCGAT
CTACGATGCGTATACGCTGTACGCCATATACATGTTCATGCCGGTGCCGT
ACCTGCTGCAGCCGTTTGTCCTTGGATCGGCAGTCACCTTTTGCTACATA
ATAAACTACAGCTTCGTGATCACCGCCAAGGATGACAACCAAATGCACAG
CATCCTGAACGAGGCCATATACCTGAGCTGTGTCAACCTACTGGGCATTT
TCTTTCGCCTGATGAGGGATATAGCGCTACGCACCACCTTCCTCGATCGC
CGGCAGTATGTGGAGGAGAATCTCCTGTTGCGCTATGCCAGGGATCAGGA
GCGGAGTCTCTTGCTTAGCATCCTGCCTGCCCAGATCGCCGATCGGCTGC
AGGAGGATGTGAAGAACCGCATCGAGCGATCCAAGCAGCAGCACCAGCAG
CAGTCGCAGGTGGATCTGCGCAGGAGTGCGGATAGCCAGACCCTTAAAAG
GTGGCGACAACCGGACCATGGCACCCTCTTCATTGAGCCCCACGAAGATG
TCACCGTCCTCTACGCGGATGTGGTCAACTACACCCACTTGACCACCACC
CTGGATGTGAAGAAGCTAGTGGAGGCTCTGCACGATCTCTTCGTGCGTTT
CGACATTGCCAGCGAGGAGTACAACGTGCTGAGGATCAAGTTCCTGGGCG
ATTGCTACTACTGCGTGGCTGGGCTGGCCAATCCCAATGCGGATCACGCC
AAGTGCTGCGTGGATCTGGGACTGCGTATGATCAAGGACATTCGAGATGT
CAGAGAGAAGCGCCATCTGAATATCGACATGCGAATCGGCGTCCACTCGG
GCGATGTCCTATCCGGCGTAATTGGAGCCGCCAAGTGGCAGTTTGACATA
TGGTCGAAGGACGTGGATATTGCCAATCGCCTGGAGGCCACTGGAGCCAC
AGGACGAGTGCATGTGAGCCAGAAGACCCTATCCCTGCTGGATGGCGAGT
ACTTCTTCGAGGACGGCACCGAAAAGGCTCGAGAGGATCCGGTGCTGCAG
AAGCACGGCATTCGCACCTTCCTTATCAAGTCACTGCGCGCCCCCATGCA
TGACCCGCGTCGCAGGATGAGGGAGCGGCAGGTGAAGAAGCTGAGCGAGG
CCAGCAAGGCCAACTTTATGCACAACTCCACGCTCCACCAGTACAACCAG
GTGCGCAACCAGGCCAAGCTGGAGATGTGTCGCGAGCTGGACAAGATGCC
CATCGGCAGGATACAGCTCACCAAAGTCTTCCGGCGAAGCACTCGGCTCA
CCCAGGACGAAATCGAAGAAGAGACCTTTCGACGCAACATCAGCTCCTGC
TGTCTGTTCTTTCGCATCCGCAACTGGGAGTTCCAGTATATCAAGGAGCC
GGATGTGATGCTCAAGTACAGCATTGCTTTGGCTTGGGTCATTTACATGG
GTCTGCTGACCATCCAGCTGCTGAGCAAGGATGCTCGCTATCACTACTGG
TACATAGATGGCACCACGATTATCCTGCTCACCATGCTGCTGATCGTGTC
CTGGTACAAGAAGCTCTGGATCATGTACATGTCCGATGCGGATGTGTCCT
CGCCGAACGGCCGGCTCAGTGGCTTCCTCTTCCGCATGTCGGATGAGATG
CAGCGCAATGTGGTCATCCGGGTGGTGATGTACTTCCTGATCATCTTCTC
CTATTGCGCGGTGGCCATTATGCAAGTGGTGGGATGCAGCAGTGACGAGG
ACTACGCGGATCTGGATCCGACCTACGACGAGCGGGTTCAGTGCTTTCAT
CCTTGGATACTCACCAATTGCATGACCCTGGTAATTGGCATGTCCTTCCT
CTTCACGCGAATCCCCTTCATCATCAAGTCCTGCTTCTCTGCTTTGATAA
TGATCGGCTACGCGGTGCTGGTGGTGTCCGAGTTCAACTTCATCTACGCC
AACAGCCCCTCCACCAATGTGAACTTCAACGCCAAGTACTCGCATATCCT
GCTGATGATCATAACGTTCGGCATTTTTCACTTGATGGAGCGGCAGACGG
AGTTCATTGCCAAAGTGGATTACAACTGGAAACGGCAGCTAATTAAGAAG
CAGGAGGACGCCCTGATCACCAATGACACCATTAAAGTGCTCCTCACCAA
TATTCTGCCCACACATGTTGCCGACTTCTATCTGTCGAATCAACTGCAGA
ACGAGCTCTACTACGAGGAGTACGATAATGTGGCCGTGATGTTCGCCTCG
ATCAAAAACTTCGACACCGACAAGATCGGACTGCGGGTGCTCAATGAGAT
TATCTGCGACTTTGACGATGTGTTGAACAAGTACTCGCAGAGTCTGCGCG
TGGAGAAGATCAAGGTGGCCAACTGGACGTACATGGCGGCCTGTGGCCTA
GACGTCTCTCGTTCGGAGCAGGTGAACGCCCCGCAGATGAAGTTCCGCAA
CGTTTCCCTCATGCCCAACGGGCGCAGGAGTCGCTACGACGGAGCACGAA
GCTCCAATGCGGACGGAGTGCAGCGGGTGCCGTACGGAAACGGCAGCAAC
ATAGCCCTGGATCTCGACTTGGAGCGGGGTCAGTACGAGGGCAACGTGAT
CACCAGCGGGCCGCGCATCAGTAGCACCCACAACGGGAGCAGCAGCAACG
AGGTGGTGCGCGTGATGGCCGAGTTCGCCCTGGACCTGATGCGCACGATG
CGCCGCTTCAACACGGAGAACATGCAGACGGAGTACGAGGGCAGCACCGA
CTACGGCATGCTGAGGATCGGCATCTCGCACGGCAGGGCCATGGCCGGGG
TGGTGGGCATCTCGAAGCCCCACTATGACATCTGGGGCAATCCCGTGAAC
ATGGCCTCGCGCATGGACTCCACCGGCGTGCCCGGCCAGATTCAGGTCAC
CGAGAACACGGCGCTTAAGCTGCGCGAGTTTAACATTCAGTGCAACTACC
GCGGCATGACCTTCGTCAAGGGGCGTGGCAACATTCCCACCTACATCATC
GGCATCGACAGCGAATACCAGTTCCTGCCACATCGCCCGGCCGCGCCAAC
CAAAGAAGACTAGCTGAAATTTACCAGAGATTAGATTTAGGACATGCATG
TATGTAAATATAGAGTATAATAGGTTTAGGACAGTCGCAAATAAAAGCTG
TAATTCGAACAAAAAAAAAAAAAAA

FI03459.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
ACXD-RA 4137 ACXD-RA 10..4123 1..4114 20555 99.9 Plus
ACXE-RA 3447 ACXE-RA 3026..3108 3741..3823 190 81.9 Plus
ACXE.a 3512 ACXE.a 3080..3162 3741..3823 190 81.9 Plus
ACXE-RA 3447 ACXE-RA 1052..1134 1620..1702 175 80.7 Plus
ACXE.a 3512 ACXE.a 1088..1170 1620..1702 175 80.7 Plus
ACXE-RA 3447 ACXE-RA 929..1022 1497..1590 155 77.6 Plus
ACXE.a 3512 ACXE.a 965..1058 1497..1590 155 77.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2242283..2243121 3272..4110 4195 100 Plus
chr3L 24539361 chr3L 2238492..2239316 647..1471 4080 99.6 Plus
chr3L 24539361 chr3L 2237010..2237414 1..405 2025 100 Plus
chr3L 24539361 chr3L 2241019..2241343 2432..2756 1625 100 Plus
chr3L 24539361 chr3L 2240157..2240445 1752..2040 1445 100 Plus
chr3L 24539361 chr3L 2239378..2239660 1471..1753 1415 100 Plus
chr3L 24539361 chr3L 2241404..2241673 2756..3025 1320 99.3 Plus
chr3L 24539361 chr3L 2237707..2237950 404..647 1220 100 Plus
chr3L 24539361 chr3L 2240748..2240963 2216..2431 1080 100 Plus
chr3L 24539361 chr3L 2240510..2240686 2040..2216 885 100 Plus
chr3L 24539361 chr3L 2241885..2242041 3120..3276 770 99.4 Plus
chr3L 24539361 chr3L 2241734..2241828 3026..3120 475 100 Plus
chrX 22417052 chrX 14684578..14684649 3836..3765 195 84.7 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
ACXD-RA 3489 CG5712-PA 1..3489 525..4013 17445 100 Plus
ACXD-RB 1521 CG5712-PB 1..1515 525..2039 7575 100 Plus
rut-RF 4524 CG9533-PF 3037..3108 3765..3836 195 84.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:31 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
ACXD-RA 4112 CG5712-RA 3..4112 1..4110 20550 100 Plus
ACXD-RB 4118 CG5712-RB 3..4118 1..4110 20455 99.9 Plus
rut-RF 7905 CG9533-RF 3415..3486 3765..3836 195 84.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
ACXD-PA 1162 CG5712-PA 1..1162 525..4010 5913 100 Plus
ACXD-PB 506 CG5712-PB 1..505 525..2039 2539 100 Plus
ACXE-PB 1123 CG17178-PB 15..1083 618..3986 1919 39.2 Plus
ACXC-PA 1130 CG5983-PA 8..1094 558..3977 1912 39.7 Plus
ACXA-PA 1112 CG17176-PA 24..1089 615..3977 1885 39.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2242881..2243723 3272..4114 4200 99.9 Plus
3L 28110227 3L 2239092..2239916 647..1471 4125 100 Plus
3L 28110227 3L 2237610..2238014 1..405 2025 100 Plus
3L 28110227 3L 2241619..2241943 2432..2756 1625 100 Plus
3L 28110227 3L 2240757..2241045 1752..2040 1445 100 Plus
3L 28110227 3L 2239978..2240260 1471..1753 1415 100 Plus
3L 28110227 3L 2242004..2242273 2756..3025 1350 100 Plus
3L 28110227 3L 2238307..2238550 404..647 1220 100 Plus
3L 28110227 3L 2241348..2241563 2216..2431 1080 100 Plus
3L 28110227 3L 2241110..2241286 2040..2216 885 100 Plus
3L 28110227 3L 2242483..2242639 3120..3276 770 99.4 Plus
3L 28110227 3L 2242335..2242429 3026..3120 475 100 Plus
X 23542271 X 14794274..14794345 3836..3765 195 84.7 Minus
2L 23513712 2L 12929387..12929469 3741..3823 190 81.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2242881..2243723 3272..4114 4200 99.8 Plus
3L 28103327 3L 2239092..2239916 647..1471 4125 100 Plus
3L 28103327 3L 2237610..2238014 1..405 2025 100 Plus
3L 28103327 3L 2241619..2241943 2432..2756 1625 100 Plus
3L 28103327 3L 2240757..2241045 1752..2040 1445 100 Plus
3L 28103327 3L 2239978..2240260 1471..1753 1415 100 Plus
3L 28103327 3L 2242004..2242273 2756..3025 1350 100 Plus
3L 28103327 3L 2238307..2238550 404..647 1220 100 Plus
3L 28103327 3L 2241348..2241563 2216..2431 1080 100 Plus
3L 28103327 3L 2241110..2241286 2040..2216 885 100 Plus
3L 28103327 3L 2242483..2242639 3120..3276 770 99.3 Plus
3L 28103327 3L 2242335..2242429 3026..3120 475 100 Plus
X 23527363 X 14802372..14802443 3836..3765 195 84.7 Minus
2L 23513712 2L 12929387..12929469 3741..3823 190 81.9 Plus
2L 23513712 2L 12913819..12913909 1622..1712 185 80.2 Plus
3L 28103327 3L 2250134..2250189 1831..1886 175 87.5 Plus
2L 23513712 2L 12926894..12926976 1620..1702 175 80.7 Plus
2L 23513712 2L 12916509..12916576 3876..3943 175 83.8 Plus
2L 23513712 2L 12920709..12920778 3890..3959 170 82.8 Plus
2L 23513712 2L 12926771..12926864 1497..1590 155 77.6 Plus
2L 23513712 2L 12922298..12922391 1497..1590 155 77.6 Plus
3L 28103327 3L 2251658..2251726 3154..3222 150 81.1 Plus
3L 28103327 3L 2248166..2248240 3741..3815 150 80 Plus
2L 23513712 2L 12922423..12922470 1622..1669 150 87.5 Plus
2L 23513712 2L 12920560..12920636 3741..3817 145 79.2 Plus
Blast to na_te.dros performed 2014-11-27 05:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6784..6844 3541..3601 125 67.2 Plus

FI03459.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:37:02 Download gff for FI03459.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2242284..2243121 3273..4110 100   Plus
chr3L 2241886..2242037 3121..3272 100 -> Plus
chr3L 2241734..2241828 3026..3120 100 -> Plus
chr3L 2241405..2241673 2757..3025 99 -> Plus
chr3L 2241019..2241343 2432..2756 100 -> Plus
chr3L 2240748..2240963 2216..2431 100 -> Plus
chr3L 2240510..2240685 2040..2215 100 -> Plus
chr3L 2240159..2240444 1754..2039 100 -> Plus
chr3L 2239379..2239660 1472..1753 100 -> Plus
chr3L 2238493..2239316 648..1471 99 -> Plus
chr3L 2237708..2237950 405..647 100 -> Plus
chr3L 2237010..2237413 1..404 94 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:44:24 Download gff for FI03459.complete
Subject Subject Range Query Range Percent Splice Strand
ACXD-RA 1..3489 525..4013 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:20:22 Download gff for FI03459.complete
Subject Subject Range Query Range Percent Splice Strand
ACXD-RA 1..3489 525..4013 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:39:18 Download gff for FI03459.complete
Subject Subject Range Query Range Percent Splice Strand
ACXD-RA 1..3489 525..4013 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:37:02 Download gff for FI03459.complete
Subject Subject Range Query Range Percent Splice Strand
ACXD-RA 1..3489 525..4013 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-12 15:56:48 Download gff for FI03459.complete
Subject Subject Range Query Range Percent Splice Strand
ACXD-RA 1..4110 1..4110 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:20:22 Download gff for FI03459.complete
Subject Subject Range Query Range Percent Splice Strand
ACXD-RA 1..4110 1..4110 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:39:18 Download gff for FI03459.complete
Subject Subject Range Query Range Percent Splice Strand
ACXD-RA 3..4112 1..4110 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:37:02 Download gff for FI03459.complete
Subject Subject Range Query Range Percent Splice Strand
ACXD-RA 3..4112 1..4110 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:37:02 Download gff for FI03459.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2242882..2243719 3273..4110 100   Plus
3L 2242484..2242635 3121..3272 100 -> Plus
3L 2242335..2242429 3026..3120 100 -> Plus
3L 2242005..2242273 2757..3025 100 -> Plus
3L 2241619..2241943 2432..2756 100 -> Plus
3L 2241348..2241563 2216..2431 100 -> Plus
3L 2241110..2241285 2040..2215 100 -> Plus
3L 2240759..2241044 1754..2039 100 -> Plus
3L 2239979..2240260 1472..1753 100 -> Plus
3L 2239093..2239916 648..1471 100 -> Plus
3L 2238308..2238550 405..647 100 -> Plus
3L 2237610..2238013 1..404 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:39:18 Download gff for FI03459.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2242882..2243719 3273..4110 100   Plus
arm_3L 2242484..2242635 3121..3272 100 -> Plus
arm_3L 2242335..2242429 3026..3120 100 -> Plus
arm_3L 2242005..2242273 2757..3025 100 -> Plus
arm_3L 2241619..2241943 2432..2756 100 -> Plus
arm_3L 2241348..2241563 2216..2431 100 -> Plus
arm_3L 2241110..2241285 2040..2215 100 -> Plus
arm_3L 2240759..2241044 1754..2039 100 -> Plus
arm_3L 2239979..2240260 1472..1753 100 -> Plus
arm_3L 2239093..2239916 648..1471 100 -> Plus
arm_3L 2238308..2238550 405..647 100 -> Plus
arm_3L 2237610..2238013 1..404 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:51:49 Download gff for FI03459.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2242882..2243719 3273..4110 100   Plus
3L 2242484..2242635 3121..3272 100 -> Plus
3L 2242335..2242429 3026..3120 100 -> Plus
3L 2242005..2242273 2757..3025 100 -> Plus
3L 2241619..2241943 2432..2756 100 -> Plus
3L 2241348..2241563 2216..2431 100 -> Plus
3L 2241110..2241285 2040..2215 100 -> Plus
3L 2240759..2241044 1754..2039 100 -> Plus
3L 2239979..2240260 1472..1753 100 -> Plus
3L 2239093..2239916 648..1471 100 -> Plus
3L 2238308..2238550 405..647 100 -> Plus
3L 2237610..2238013 1..404 100 -> Plus

FI03459.pep Sequence

Translation from 524 to 4012

> FI03459.pep
MDSYFDSAIEYNRSNPISLARTSSQAQTVQNEKNWEWSYLVRKCRNLELE
DSYDLYMRRLRVGYLSLFIFIHVAVTVIHTLLLLTTPEIKYVYVDMVAYM
CSGLVIWVVLGVNFRSELVSKHGWVVYATSWLAVCVMVLMDIGLNVYHAT
SHNDILNPIYDAYTLYAIYMFMPVPYLLQPFVLGSAVTFCYIINYSFVIT
AKDDNQMHSILNEAIYLSCVNLLGIFFRLMRDIALRTTFLDRRQYVEENL
LLRYARDQERSLLLSILPAQIADRLQEDVKNRIERSKQQHQQQSQVDLRR
SADSQTLKRWRQPDHGTLFIEPHEDVTVLYADVVNYTHLTTTLDVKKLVE
ALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNADHAKCCVDLGL
RMIKDIRDVREKRHLNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIA
NRLEATGATGRVHVSQKTLSLLDGEYFFEDGTEKAREDPVLQKHGIRTFL
IKSLRAPMHDPRRRMRERQVKKLSEASKANFMHNSTLHQYNQVRNQAKLE
MCRELDKMPIGRIQLTKVFRRSTRLTQDEIEEETFRRNISSCCLFFRIRN
WEFQYIKEPDVMLKYSIALAWVIYMGLLTIQLLSKDARYHYWYIDGTTII
LLTMLLIVSWYKKLWIMYMSDADVSSPNGRLSGFLFRMSDEMQRNVVIRV
VMYFLIIFSYCAVAIMQVVGCSSDEDYADLDPTYDERVQCFHPWILTNCM
TLVIGMSFLFTRIPFIIKSCFSALIMIGYAVLVVSEFNFIYANSPSTNVN
FNAKYSHILLMIITFGIFHLMERQTEFIAKVDYNWKRQLIKKQEDALITN
DTIKVLLTNILPTHVADFYLSNQLQNELYYEEYDNVAVMFASIKNFDTDK
IGLRVLNEIICDFDDVLNKYSQSLRVEKIKVANWTYMAACGLDVSRSEQV
NAPQMKFRNVSLMPNGRRSRYDGARSSNADGVQRVPYGNGSNIALDLDLE
RGQYEGNVITSGPRISSTHNGSSSNEVVRVMAEFALDLMRTMRRFNTENM
QTEYEGSTDYGMLRIGISHGRAMAGVVGISKPHYDIWGNPVNMASRMDST
GVPGQIQVTENTALKLREFNIQCNYRGMTFVKGRGNIPTYIIGIDSEYQF
LPHRPAAPTKED*

FI03459.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24856-PA 1163 GF24856-PA 1..1163 1..1162 5794 92 Plus
Dana\GF23420-PA 1132 GF23420-PA 25..1094 31..1151 1926 38.3 Plus
Dana\GF14211-PA 1703 GF14211-PA 627..1680 43..1160 1883 38.3 Plus
Dana\GF23423-PA 1128 GF23423-PA 28..1094 32..1151 1862 37.3 Plus
Dana\GF14210-PA 1119 GF14210-PA 22..1087 31..1151 1800 38.2 Plus
Dana\GF14211-PA 1703 GF14211-PA 28..553 30..548 1014 41.2 Plus
Dana\GF14211-PA 1703 GF14211-PA 548..625 839..916 191 48.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14845-PA 1162 GG14845-PA 1..1162 1..1162 6042 97.5 Plus
Dere\GG23802-PA 1124 GG23802-PA 15..1080 32..1151 2040 40.8 Plus
Dere\GG23798-PA 1130 GG23798-PA 27..1097 31..1154 1973 39.2 Plus
Dere\GG23799-PA 1122 GG23799-PA 22..1090 31..1152 1967 39.9 Plus
Dere\GG23801-PA 1099 GG23801-PA 23..1091 31..1154 1909 39.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14999-PA 1163 GH14999-PA 1..1163 1..1159 5012 79.2 Plus
Dgri\GH16698-PA 1090 GH16698-PA 10..1067 32..1156 2120 40.6 Plus
Dgri\GH16681-PA 1087 GH16681-PA 8..1065 30..1150 1974 39.6 Plus
Dgri\GH15000-PA 998 GH15000-PA 1..965 49..1145 1277 31.8 Plus
Dgri\GH12907-PA 259 GH12907-PA 1..259 578..834 988 70.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
ACXD-PA 1162 CG5712-PA 1..1162 1..1162 6060 100 Plus
ACXD-PB 506 CG5712-PB 1..505 1..505 2627 100 Plus
ACXC-PA 1130 CG5983-PA 8..1094 12..1151 1962 39.6 Plus
ACXE-PB 1123 CG17178-PB 15..1083 32..1154 1957 39.2 Plus
ACXA-PA 1112 CG17176-PA 24..1089 31..1151 1926 39.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13162-PA 1149 GI13162-PA 4..1148 10..1162 4981 78.9 Plus
Dmoj\GI13944-PA 1086 GI13944-PA 13..1069 35..1150 2003 39.6 Plus
Dmoj\GI13927-PA 1066 GI13927-PA 1..1045 42..1151 1990 39.5 Plus
Dmoj\GI11367-PA 1085 GI11367-PA 6..1073 28..1154 1967 39.8 Plus
Dmoj\GI11385-PA 1012 GI11385-PA 14..489 30..515 1062 42.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:12:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24639-PA 1166 GL24639-PA 1..1163 1..1161 5605 89.1 Plus
Dper\GL24785-PA 1125 GL24785-PA 18..1085 32..1151 2147 41.6 Plus
Dper\GL24640-PA 884 GL24640-PA 1..873 230..1162 1585 36.7 Plus
Dper\GL24732-PA 708 GL24732-PA 17..675 31..713 1228 40.5 Plus
Dper\GL24731-PA 997 GL24731-PA 4..686 20..716 1201 39.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19077-PA 1166 GA19077-PA 1..1163 1..1161 5595 89 Plus
Dpse\GA28911-PA 1125 GA28911-PA 18..1086 32..1152 2163 41.8 Plus
Dpse\GA28951-PA 1123 GA28951-PA 17..1081 31..1151 2137 41.8 Plus
Dpse\GA28949-PA 1136 GA28949-PA 4..1106 20..1152 2038 40.1 Plus
Dpse\GA16819-PA 1097 GA16819-PA 15..1086 26..1162 1740 35 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14470-PA 949 GM14470-PA 1..941 1..941 5033 99 Plus
Dsec\GM10065-PA 1130 GM10065-PA 9..1097 13..1154 1968 39.6 Plus
Dsec\GM10078-PA 1123 GM10078-PA 13..1083 30..1154 1942 39.1 Plus
Dsec\GM10070-PA 1117 GM10070-PA 21..1085 31..1152 1922 38.7 Plus
Dsec\GM10075-PA 755 GM10075-PA 24..732 31..751 1175 37.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13671-PA 1161 GD13671-PA 1..1161 1..1162 6139 98.6 Plus
Dsim\GD23854-PA 1130 GD23854-PA 9..1097 13..1154 1972 39.6 Plus
Dsim\GD23858-PA 1117 GD23858-PA 13..1077 30..1154 1942 39.6 Plus
Dsim\GD23855-PA 1095 GD23855-PA 21..1063 31..1152 1781 36.7 Plus
Dsim\GD23856-PA 1073 GD23856-PA 24..1016 31..1078 1657 37.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11936-PA 1152 GJ11936-PA 4..1152 11..1159 5023 80.8 Plus
Dvir\GJ11641-PA 1097 GJ11641-PA 6..1078 21..1159 2181 41.1 Plus
Dvir\GJ11622-PA 1099 GJ11622-PA 9..1073 31..1150 2139 41.2 Plus
Dvir\GJ11937-PA 997 GJ11937-PA 43..952 160..1150 1367 34 Plus
Dvir\GJ11335-PA 1302 GJ11335-PA 168..503 163..512 598 37.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12535-PA 1158 GK12535-PA 1..1157 1..1157 5238 83.2 Plus
Dwil\GK15554-PA 1116 GK15554-PA 16..1076 32..1151 2155 42.5 Plus
Dwil\GK12536-PA 931 GK12536-PA 83..904 259..1150 1573 39.1 Plus
Dwil\GK16713-PA 1363 GK16713-PA 138..500 125..505 606 35.1 Plus
Dwil\GK24141-PA 1182 GK24141-PA 188..515 166..530 593 33.2 Plus
Dwil\GK16713-PA 1363 GK16713-PA 861..1355 594..1142 531 28.9 Plus
Dwil\GK16713-PA 1363 GK16713-PA 1109..1329 236..472 189 24.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21209-PA 1162 GE21209-PA 1..1162 1..1162 6191 98.4 Plus
Dyak\GE18605-PA 1129 GE18605-PA 9..1097 13..1154 1999 39.1 Plus
Dyak\GE18608-PA 1120 GE18608-PA 15..1079 32..1151 1983 39.1 Plus
Dyak\GE18607-PA 1115 GE18607-PA 24..1092 31..1154 1882 38.5 Plus
Dyak\GE18606-PA 1120 GE18606-PA 22..1089 31..1151 1818 39.4 Plus

FI03459.hyp Sequence

Translation from 524 to 4012

> FI03459.hyp
MDSYFDSAIEYNRSNPISLARTSSQAQTVQNEKNWEWSYLVRKCRNLELE
DSYDLYMRRLRVGYLSLFIFIHVAVTVIHTLLLLTTPEIKYVYVDMVAYM
CSGLVIWVVLGVNFRSELVSKHGWVVYATSWLAVCVMVLMDIGLNVYHAT
SHNDILNPIYDAYTLYAIYMFMPVPYLLQPFVLGSAVTFCYIINYSFVIT
AKDDNQMHSILNEAIYLSCVNLLGIFFRLMRDIALRTTFLDRRQYVEENL
LLRYARDQERSLLLSILPAQIADRLQEDVKNRIERSKQQHQQQSQVDLRR
SADSQTLKRWRQPDHGTLFIEPHEDVTVLYADVVNYTHLTTTLDVKKLVE
ALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNADHAKCCVDLGL
RMIKDIRDVREKRHLNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIA
NRLEATGATGRVHVSQKTLSLLDGEYFFEDGTEKAREDPVLQKHGIRTFL
IKSLRAPMHDPRRRMRERQVKKLSEASKANFMHNSTLHQYNQVRNQAKLE
MCRELDKMPIGRIQLTKVFRRSTRLTQDEIEEETFRRNISSCCLFFRIRN
WEFQYIKEPDVMLKYSIALAWVIYMGLLTIQLLSKDARYHYWYIDGTTII
LLTMLLIVSWYKKLWIMYMSDADVSSPNGRLSGFLFRMSDEMQRNVVIRV
VMYFLIIFSYCAVAIMQVVGCSSDEDYADLDPTYDERVQCFHPWILTNCM
TLVIGMSFLFTRIPFIIKSCFSALIMIGYAVLVVSEFNFIYANSPSTNVN
FNAKYSHILLMIITFGIFHLMERQTEFIAKVDYNWKRQLIKKQEDALITN
DTIKVLLTNILPTHVADFYLSNQLQNELYYEEYDNVAVMFASIKNFDTDK
IGLRVLNEIICDFDDVLNKYSQSLRVEKIKVANWTYMAACGLDVSRSEQV
NAPQMKFRNVSLMPNGRRSRYDGARSSNADGVQRVPYGNGSNIALDLDLE
RGQYEGNVITSGPRISSTHNGSSSNEVVRVMAEFALDLMRTMRRFNTENM
QTEYEGSTDYGMLRIGISHGRAMAGVVGISKPHYDIWGNPVNMASRMDST
GVPGQIQVTENTALKLREFNIQCNYRGMTFVKGRGNIPTYIIGIDSEYQF
LPHRPAAPTKED*

FI03459.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
ACXD-PA 1162 CG5712-PA 1..1162 1..1162 6060 100 Plus
ACXD-PB 506 CG5712-PB 1..505 1..505 2627 100 Plus
ACXC-PA 1130 CG5983-PA 8..1094 12..1151 1962 39.6 Plus
ACXE-PB 1123 CG17178-PB 15..1083 32..1154 1957 39.2 Plus
ACXA-PA 1112 CG17176-PA 24..1089 31..1151 1926 39.3 Plus